TkA02G086800 | RubberDandelionOmics

Gene overview

TkA02G086800

Reference: TK1151 Chr: Chr02 Coordinates: 22577567-22580501 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1578 bp · TkA02G086800|TK1151|cDNA

AAACGCGTGAACATTGAATATCTCCCCTATTCCCAATTACACATTCAATGCTGCACTACCCAAAATACATGGAAGACTAAACCCACACTCAAACCCCATCAAATTCTCACGTATTCATAGTTCATTCCTTAACCCATTTACACATTATTCATCCATGATTCATGGGTTTCTCTTTGATTTTGATCTTAACTCTTTCTTCATTCATCTTCGATCTTCTATCTCCGACATATGGATATGATTCACTGGATCCTAATGGCAAT...

CDS

Download CDS FASTA

1296 bp · TkA02G086800|TK1151|CDS

ATGGGTTTCTCTTTGATTTTGATCTTAACTCTTTCTTCATTCATCTTCGATCTTCTATCTCCGACATATGGATATGATTCACTGGATCCTAATGGCAATATCACCATCAAATGGGATCTCCGGCAGCAGAATGACGGAACACAGGATATACTAGTTTCGATCTACAACTACCAATTATATCGGCACATAGAGACTCCTGGATGGAAGCTAAGTTGGAAATGGAGTGGCAAAGAAGTAATTTGGGACATGAGAGGGGCCGA...

Protein

Download Protein FASTA

431 aa · TkA02G086800|TK1151|PROTEIN

MGFSLILILTLSSFIFDLLSPTYGYDSLDPNGNITIKWDLRQQNDGTQDILVSIYNYQLYRHIETPGWKLSWKWSGKEVIWDMRGAEATEQGNCSEYLGKPQLPHSCVREPVIVDLLPGSPYNMQVQNCCKGGVLSSFSQDPGNSMAAFQMNVGSIATMPYNFNIGIAGYTCGNATSVPPTKFVTDHGRRQTQALGTWNITCTYSPFLASSAPKCCVSLSSFYSKTIVPCPVCSCACQGEPGSNCVRHGQMHSVLRLPPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G086800`
TK1151 ID	TkA02G086800
OH-1004 ID	LXL04_016970
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G086800

Location Chr02:22577567-22580501 (-)

Description Similar to BC1L6: COBRA-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09790`	COBRA-like protein 6.	No verified direct reference in this release
`At3g02210`	COBRA-like protein 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0604300`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os03g0416300`	COBRA-like protein 2.	No verified direct reference in this release
`Os05g0386800`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016970 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010215 cellulose microfibril organization Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G09790

ath:AT3G02210

dosa:Os03g0416300

dosa:Os05g0386800

dosa:Os07g0604300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.764

Rank 1 · TkA02G086800 · TK1151

Cytoplasm0.104

Rank 2 · TkA02G086800 · TK1151

Endoplasmic reticulum0.087

Rank 3 · TkA02G086800 · TK1151

Extracellular0.084

Rank 4 · TkA02G086800 · TK1151

Lysosome / Vacuole0.080

Rank 5 · TkA02G086800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25079COB_C33-58 aa

PF04833COBRA_N51-205 aa

PF25079COB_C214-399 aa

PF04833COBRA_N292-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G086800	`PF25079`	COB_C	33	58	2.9e-43	149.0
TkA02G086800	`PF04833`	COBRA_N	51	205	3.6e-57	193.6
TkA02G086800	`PF25079`	COB_C	214	399	2.9e-43	149.0
TkA02G086800	`PF04833`	COBRA_N	292	311	3.6e-57	193.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04500`	Arabidopsis thaliana	sp\|O04500\|COBL6_ARATH COBRA-like protein 6	55.800%	Swiss-Prot	High
`Q9SRT7`	Arabidopsis thaliana	sp\|Q9SRT7\|COBL1_ARATH COBRA-like protein 1	51.200%	Swiss-Prot	High
`Q6Z4G8`	Oryza sativa subsp. japonica	sp\|Q6Z4G8\|COBL1_ORYSJ COBRA-like protein 1	54.200%	Swiss-Prot	High
`Q75IW1`	Oryza sativa subsp. japonica	sp\|Q75IW1\|COBL2_ORYSJ COBRA-like protein 2	55.400%	Swiss-Prot	High
`Q60E70`	Oryza sativa subsp. japonica	sp\|Q60E70\|COBL3_ORYSJ COBRA-like protein 3	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card