TkA02G084980 | RubberDandelionOmics

Gene overview

TkA02G084980

Reference: TK1151 Chr: Chr02 Coordinates: 22077770-22079663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1027 bp · TkA02G084980|TK1151|cDNA

TGGGACTATACCTAATTCAGTCCCGGCACAACATTTATAAGTCTAAATCCCTGAATTCTTCCCGAAATTACTTCAGATCCCGCGATCGAAGGTGTTTTCTCTGGTTCCCATTTCCGGCTACCACTCCGGCGACGCTCCGACGAGGCTCCAGGTATCAGACGCTTCGGCGACGAACTCCACTCCGACGCGAAGGCCACCAGCCCCCTGTTTATGTTCGCTGCGTTCCTCCGATACTTCTGTGTCGCGACCGTGAGAAGTGC...

CDS

Download CDS FASTA

450 bp · TkA02G084980|TK1151|CDS

ATGGAAGCTTGGCTGGATTTAGCAAATATATACACAAAGCTTGAGTCTTTTTCTGATGCTGAAATTTGTGTTGGCAAAGCAAAGTCAAAGGAATTCTACTACCCTCGAGCTTGGCATTCTACAGGTTTGTTGTTTGAAGCTCAATCGTTACACAAGGAAATTCTTGTGGCGTATTCGATTTCACTATCAATACAACCGGATTTCATCCCAAGTTTAGTTTCAACAGCAGAAACATTAATAAAAATGGGAGGGAGTGGGAG...

Protein

Download Protein FASTA

149 aa · TkA02G084980|TK1151|PROTEIN

MEAWLDLANIYTKLESFSDAEICVGKAKSKEFYYPRAWHSTGLLFEAQSLHKEILVAYSISLSIQPDFIPSLVSTAETLIKMGGSGSGTHTVPIARSFLMNTLRLEPTNHDAWFNLGLICKKEGLMRQAADFFQAAHELKLSAPVQSFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G084980`
TK1151 ID	TkA02G084980
OH-1004 ID	LXL04_007922
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.900
Protein coverage (%)	TK1151 100.000 / OH-1004 19.643 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G084980

Location Chr02:22077770-22079663 (+)

Description Similar to NPGR1: Protein NPGR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27460`	Protein NPGR1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007922 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0098857 membrane microdomain Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G27460

ath:AT2G43040

ath:AT4G28600

hsa:145567

mmu:104718

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.555

Rank 1 · TkA02G084980 · TK1151

Nucleus0.396

Rank 2 · TkA02G084980 · TK1151

Mitochondrion0.073

Rank 3 · TkA02G084980 · TK1151

Peroxisome0.071

Rank 4 · TkA02G084980 · TK1151

Cell membrane0.045

Rank 5 · TkA02G084980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27595HIR3_bundle1-13 aa

PF00515TPR_12-23 aa

PF13431TPR_172-19 aa

PF07719TPR_22-27 aa

PF13181TPR_82-27 aa

PF25063ARM_TT21_C2-60 aa

PF13432TPR_162-21 aa

PF13428TPR_142-23 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G084980	`PF27595`	HIR3_bundle	1	13	0.046	13.6
TkA02G084980	`PF00515`	TPR_1	2	23	1.1e-09	38.4
TkA02G084980	`PF13431`	TPR_17	2	19	6.7e-08	32.9
TkA02G084980	`PF07719`	TPR_2	2	27	1.2e-06	28.9
TkA02G084980	`PF13181`	TPR_8	2	27	4.1e-06	27.2
TkA02G084980	`PF25063`	ARM_TT21_C	2	60	4.2e-06	27.5
TkA02G084980	`PF13432`	TPR_16	2	21	0.0017	19.5
TkA02G084980	`PF13428`	TPR_14	2	23	0.0019	19.4
TkA02G084980	`PF14559`	TPR_19	2	24	0.0022	19.0
TkA02G084980	`PF23914`	TPR_CcmH_CycH	2	27	0.0024	18.4
TkA02G084980	`PF30990`	TTC22_N	2	29	0.0055	17.1
TkA02G084980	`PF13414`	TPR_11	2	13	0.023	15.1
TkA02G084980	`PF13176`	TPR_7	3	20	0.0014	19.3
TkA02G084980	`PF29407`	CFAP70_TPR_C	3	51	0.0019	18.5
TkA02G084980	`PF13424`	TPR_12	3	22	0.033	15.1
TkA02G084980	`PF13414`	TPR_11	34	48	0.023	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CB03`	Arabidopsis thaliana	sp\|Q9CB03\|NPGR1_ARATH Protein NPGR1	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card