TkA02G077850 | RubberDandelionOmics

Gene overview

TkA02G077850

Reference: TK1151 Chr: Chr02 Coordinates: 20275621-20278870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · TkA02G077850|TK1151|cDNA

ATGGCTTCTCAAAAGAATCCACATCTCCTTCTTCCACTCACCATCTCCTTTCTCCTCTCCATTTTCCTCTCTGTTTCGGCTCAATACTCCCCTCATTATGCTTGCGACATCGATAAAAACCCTAGCTTGAAGAAATTCGCGTTCTGTAATACTTCGGTCGACGTGAAAACACGGGTTCAAGATTTGGTAAACAGGATGACGTTGCAAGAAAAGGCGGGAAGTATAGTGAGTGTAACCGATAGCATTGATCGACTTGGGAT...

CDS

Download CDS FASTA

2250 bp · TkA02G077850|TK1151|CDS

ATGGCTTCTCAAAAGAATCCACATCTCCTTCTTCCACTCACCATCTCCTTTCTCCTCTCCATTTTCCTCTCTGTTTCGGCTCAATACTCCCCTCATTATGCTTGCGACATCGATAAAAACCCTAGCTTGAAGAAATTCGCGTTCTGTAATACTTCGGTCGACGTGAAAACACGGGTTCAAGATTTGGTAAACAGGATGACGTTGCAAGAAAAGGCGGGAAGTATAGTGAGTGTAACCGATAGCATTGATCGACTTGGGAT...

Protein

Download Protein FASTA

749 aa · TkA02G077850|TK1151|PROTEIN

MASQKNPHLLLPLTISFLLSIFLSVSAQYSPHYACDIDKNPSLKKFAFCNTSVDVKTRVQDLVNRMTLQEKAGSIVSVTDSIDRLGIPSYGWWSEALHGVSDTGPATWFNKTVISGATSYPQVILTAASFNESLWNTLGKVVSTEARAMYNSGVAGLTFWSPNVNIYRDPRWGRGQETPGEDPLVVYKRTEDGDEDRLKVGACCKHYTAYDLDNWTSVDRYHFNAIFKRCVLDGNVASIMCSFNKVNGIAACGDKELLED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G077850`
TK1151 ID	TkA02G077850
OH-1004 ID	LXL04_017044
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G077850

Location Chr02:20275621-20278870 (+)

Description Similar to Xyl2: Beta-xylosidase/alpha-L-arabinofuranosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64570`	Beta-D-xylosidase showing an optimal efficiency with the natural substrate xylobiose.	No verified direct reference in this release
`At5g09730`	Involved in the hydrolysis of arabinan.	Purification, functional characterization, cloning, and identification of mutants of a seed-specific arabinan hydrolase in Arabidopsis.2006 · DOI: 10.1093/jxb/erj205
`At5g49360`	Involved in pectic arabinan modification in mucilage secretory cells.	AtBXL1, a novel higher plant (Arabidopsis thaliana) putative beta-xylosidase gene, is involved in secondary cell wall metabolism and plant development.2003 · DOI: 10.1046/j.1365-313x.2003.01654.x AtBXL1 encodes a bifunctional beta-D-xylosidase/alpha-L-arabinofuranosidase required for pectic arabinan modification in Arabidopsis mucilage secretory cells.2009 · DOI: 10.1104/pp.109.138388

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017044 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0031222 arabinan catabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0009044 xylan 1,4-beta-xylosidase activity Molecular Function

GO:0046556 alpha-L-arabinofuranosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02640

ath:AT5G09730

ath:AT5G64570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.683

Rank 1 · TkA02G077850 · TK1151

Lysosome / Vacuole0.093

Rank 2 · TkA02G077850 · TK1151

Cell membrane0.079

Rank 3 · TkA02G077850 · TK1151

Cytoplasm0.066

Rank 4 · TkA02G077850 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA02G077850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00933Glyco_hydro_3113-335 aa

PF01915Glyco_hydro_3_C381-611 aa

PF14310Fn3-like674-740 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G077850	`PF00933`	Glyco_hydro_3	113	335	4.1e-18	66.6
TkA02G077850	`PF01915`	Glyco_hydro_3_C	381	611	5.5e-51	174.1
TkA02G077850	`PF14310`	Fn3-like	674	740	1.5e-07	32.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLG1`	Arabidopsis thaliana	sp\|Q9FLG1\|BXL4_ARATH Beta-D-xylosidase 4	58.300%	Swiss-Prot	High
`Q9LXD6`	Arabidopsis thaliana	sp\|Q9LXD6\|BXL3_ARATH Beta-D-xylosidase 3	57.000%	Swiss-Prot	High
`Q9FGY1`	Arabidopsis thaliana	sp\|Q9FGY1\|BXL1_ARATH Beta-D-xylosidase 1	52.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card