TkA02G074760 | RubberDandelionOmics

Gene overview

TkA02G074760

Reference: TK1151 Chr: Chr02 Coordinates: 19389206-19395775 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3045 bp · TkA02G074760|TK1151|cDNA

CTCCATTAAAAATTAGGCACTTTCAGCCGAATTCGCGACTTGAACGAAAGGAAAAAACCGCTACCGAAAGAGAGAAACAACCACCACTTCCTTCTTCACAAATCTCACTCCTTCACATCTCTTTTAGGGTTTCGATTTGATCGATTTCTCCACAACAGAAATTCACACCAAATGGAGCACCAACACCAGCTGCATCATCATCGTTGATCAGATAGCGCGGAACGGAAACGGAGGTTTGAAAATGGCGGAAGACGGATCGG...

CDS

Download CDS FASTA

2520 bp · TkA02G074760|TK1151|CDS

ATGGCGGAAGACGGATCGGAGAGGGGGAGTACAAGTAAGGGAAATGGAGGGTTAAGTTCCATGGATTCAATGGAATCTCATCGATGGGTGTTTCAAGACGAAGAGAATTCAGAGATCGATTACGAGGACAATGGTGATGATGACGGGGATGATTTAACGTTGCAAAATGACATTGATTCGGACGATGAAGATAGTTTATACCAGAAGCTGATTCGGACCGGGCCAAGGATTGATTCGTTTGGCGTTGAAGCCCTTGAGGT...

Protein

Download Protein FASTA

839 aa · TkA02G074760|TK1151|PROTEIN

MAEDGSERGSTSKGNGGLSSMDSMESHRWVFQDEENSEIDYEDNGDDDGDDLTLQNDIDSDDEDSLYQKLIRTGPRIDSFGVEALEVPGAHRSDYEDASLGKSVFLVFQTLGVVFGDVGTSPLYTFSVMFSRAPIESNEDIIGALSLVLYTLILIPLIKYILIVLLANDDGEGGTFALYSLICRHAKISLLPNQLPSDSRISSFRLKVPSAELERSLKIKEYLETSLAMKKLVLVLVLAGTSMVIADGVVTPAMSVISAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G074760`
TK1151 ID	TkA02G074760
OH-1004 ID	LXL04_017104
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G074760

Location Chr02:19389206-19395775 (-)

Description Similar to POT7: Potassium transporter 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09400`	Probable potassium transporter.	No verified direct reference in this release
`At4g33530`	Probable potassium transporter.	No verified direct reference in this release
`At1g60160`	Putative potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0509200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os04g0610700`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017104 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0048825 cotyledon development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004016 adenylate cyclase activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G60160

ath:AT4G33530

ath:AT5G09400

dosa:Os04g0610700

dosa:Os07g0509200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.434

Rank 1 · TkA02G074760 · TK1151

Lysosome / Vacuole0.302

Rank 2 · TkA02G074760 · TK1151

Endoplasmic reticulum0.140

Rank 3 · TkA02G074760 · TK1151

Cytoplasm0.136

Rank 4 · TkA02G074760 · TK1151

Golgi apparatus0.098

Rank 5 · TkA02G074760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705K_trans106-577 aa

PF22776K_trans_C607-837 aa

PF02705K_trans635-651 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G074760	`PF02705`	K_trans	106	577	1e-141	473.3
TkA02G074760	`PF22776`	K_trans_C	607	837	1.2e-21	77.9
TkA02G074760	`PF02705`	K_trans	635	651	1e-141	473.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY75`	Arabidopsis thaliana	sp\|Q9FY75\|POT7_ARATH Potassium transporter 7	71.500%	Swiss-Prot	High
`Q8LPL8`	Arabidopsis thaliana	sp\|Q8LPL8\|POT13_ARATH Potassium transporter 13	68.200%	Swiss-Prot	High
`O80739`	Arabidopsis thaliana	sp\|O80739\|POT12_ARATH Putative potassium transporter 12	57.400%	Swiss-Prot	High
`Q69RI8`	Oryza sativa subsp. japonica	sp\|Q69RI8\|HAK14_ORYSJ Probable potassium transporter 14	67.500%	Swiss-Prot	High
`Q7XPL3`	Oryza sativa subsp. japonica	sp\|Q7XPL3\|HAK15_ORYSJ Probable potassium transporter 15	59.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card