TkA02G074600 | RubberDandelionOmics

Gene overview

TkA02G074600

Reference: TK1151 Chr: Chr02 Coordinates: 19340487-19341213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

607 bp · TkA02G074600|TK1151|cDNA

TTCAACGCCATTTCTCAAAGACCAAATCGATCGTCTTCAACCTAAGAAAGCAAAAACCTAGAAAGCAAGATAATTTGCTTGATAAAACGTGTCTAAGTCAACAAAATGGAAGAAAACGAGGAAATCGAAAAAACTCCATTGACGAACACCGTCGTCTTCATCTGCATAATTGCAGGTTCTGCTGGTTTAATGTATGGATACGACACTGCCGTTTCAGGAGGAGTAATGATGATGAAGCCCTTTCTGAAAACATTCTTCCC...

CDS

Download CDS FASTA

456 bp · TkA02G074600|TK1151|CDS

ATGGAAGAAAACGAGGAAATCGAAAAAACTCCATTGACGAACACCGTCGTCTTCATCTGCATAATTGCAGGTTCTGCTGGTTTAATGTATGGATACGACACTGCCGTTTCAGGAGGAGTAATGATGATGAAGCCCTTTCTGAAAACATTCTTCCCGGCGATCCTGGCGAAGATGGTGGACACGAAACAAGACCAGTACTGTAGGTTCAATAGCCATAGATTAACTGCGTTTATCTCGTCGATGTTCATAGCTGGTTTAGC...

Protein

Download Protein FASTA

151 aa · TkA02G074600|TK1151|PROTEIN

MEENEEIEKTPLTNTVVFICIIAGSAGLMYGYDTAVSGGVMMMKPFLKTFFPAILAKMVDTKQDQYCRFNSHRLTAFISSMFIAGLASSLLAGRVTCLIGRKFSLITSGILFLTGNGLAVFAQNVAMLIAGRLFVGFGIGFANQVCTFYIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G074600`
TK1151 ID	TkA02G074600
OH-1004 ID	LXL04_017110
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.700
Protein coverage (%)	TK1151 99.338 / OH-1004 30.426 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G074600

Location Chr02:19340487-19341213 (-)

Description Similar to STP5: Sugar transport protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34580`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release
`At3g19930`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	The sink-specific and stress-regulated Arabidopsis STP4 gene: enhanced expression of a gene encoding a monosaccharide transporter by wounding, elicitors, and pathogen challenge.1996 · DOI: 10.1105/tpc.8.12.2169

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0452700`	Mediates active uptake of hexoses by sugar:proton symport.	No verified direct reference in this release
`Os07g0106200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34580

dosa:Os01g0567500

dosa:Os04g0452700

dosa:Os07g0106200

osa:4326342

osa:4336012

rcu:8289638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.751

Rank 1 · TkA02G074600 · TK1151

Cytoplasm0.113

Rank 2 · TkA02G074600 · TK1151

Endoplasmic reticulum0.074

Rank 3 · TkA02G074600 · TK1151

Mitochondrion0.053

Rank 4 · TkA02G074600 · TK1151

Lysosome / Vacuole0.053

Rank 5 · TkA02G074600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17461DUF54236-45 aa

PF11772EpuA16-32 aa

PF00083Sugar_tr20-150 aa

PF07690MFS_173-149 aa

PF17461DUF542399-130 aa

PF11772EpuA125-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G074600	`PF17461`	DUF5423	6	45	1.5	8.4
TkA02G074600	`PF11772`	EpuA	16	32	1.4	9.3
TkA02G074600	`PF00083`	Sugar_tr	20	150	6e-20	72.3
TkA02G074600	`PF07690`	MFS_1	73	149	4.1e-06	26.7
TkA02G074600	`PF17461`	DUF5423	99	130	1.5	8.4
TkA02G074600	`PF11772`	EpuA	125	141	1.4	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y91`	Arabidopsis thaliana	sp\|Q93Y91\|STP5_ARATH Sugar transport protein 5	48.200%	Swiss-Prot	Medium
`Q39228`	Arabidopsis thaliana	sp\|Q39228\|STP4_ARATH Sugar transport protein 4	46.800%	Swiss-Prot	Medium
`Q0JCR9`	Oryza sativa subsp. japonica	sp\|Q0JCR9\|MST1_ORYSJ Sugar transport protein MST1	45.700%	Swiss-Prot	Medium
`Q7EZD7`	Oryza sativa subsp. japonica	sp\|Q7EZD7\|MST3_ORYSJ Sugar transport protein MST3	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card