TkA02G064720 | RubberDandelionOmics

Gene overview

TkA02G064720

Reference: TK1151 Chr: Chr02 Coordinates: 16823637-16824573 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · TkA02G064720|TK1151|cDNA

ATGGATTCAAAATCGGATGAATATCATGGCGATGGGCTCACATTCTTTCTTCCCGAGAACAATTCTGAGATAAAAACTGGTTCGTCCGTAGGGCTTCCCATCACTAACTCAAGAAGTACGAATTTATTTATTGTAGTGGAGTTTGATACATTTGCGAATGCGGAGTGGGATCCAAGAAACTCTAGCAATGATTTGATAGGTGATCATGTAGTTGTACTTCAGGCACTTCATTACATAATCGATATGTTGCCAGAATGGGT...

CDS

Download CDS FASTA

798 bp · TkA02G064720|TK1151|CDS

ATGGATTCAAAATCGGATGAATATCATGGCGATGGGCTCACATTCTTTCTTCCCGAGAACAATTCTGAGATAAAAACTGGTTCGTCCGTAGGGCTTCCCATCACTAACTCAAGAAGTACGAATTTATTTATTGTAGTGGAGTTTGATACATTTGCGAATGCGGAGTGGGATCCAAGAAACTCTAGCAATGATTTGATAGGTGATCATGTAGTTGTACTTCAGGCACTTCATTACATAATCGATATGTTGCCAGAATGGGT...

Protein

Download Protein FASTA

265 aa · TkA02G064720|TK1151|PROTEIN

MDSKSDEYHGDGLTFFLPENNSEIKTGSSVGLPITNSRSTNLFIVVEFDTFANAEWDPRNSSNDLIGDHVVVLQALHYIIDMLPEWVTFGFPAATGLVVQTNSVKCWAFVFNSSDLHINASNTLPPTSGSNPLNDKNITVLVVNLVVGLFVMITFLALIAFYVWRRKKSRKNEQGYDVGMNTEFEIGTRPKRFSYQELARSSGEFSENKKLGEAGFGGVYRGFLAKLGTYVAVKGCPRVQSTGSREPEPDRLEPMSHILV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G064720`
TK1151 ID	TkA02G064720
OH-1004 ID	LXL04_017243
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G064720

Location Chr02:16823637-16824573 (+)

Description Similar to LECRK91: L-type lectin-domain containing receptor kinase IX.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10530`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At4g23230`	Cysteine-rich receptor-like protein kinase 15.	No verified direct reference in this release
`At4g23190`	Cysteine-rich receptor-like protein kinase 11.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017243 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048041 focal adhesion assembly Biological Process

GO:0071318 cellular response to ATP Biological Process

GO:0106167 extracellular ATP signaling Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT3G55550

ath:AT5G10530

ath:AT5G60300

ath:AT5G65600

dosa:Os02g0640500

osa:4330111

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.629

Rank 1 · TkA02G064720 · TK1151

Endoplasmic reticulum0.162

Rank 2 · TkA02G064720 · TK1151

Cytoplasm0.102

Rank 3 · TkA02G064720 · TK1151

Lysosome / Vacuole0.082

Rank 4 · TkA02G064720 · TK1151

Extracellular0.074

Rank 5 · TkA02G064720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139Lectin_legB6-60 aa

PF04341DUF48548-60 aa

PF00139Lectin_legB81-115 aa

PF04341DUF48587-101 aa

PF22812CR_prot_dom_plant121-168 aa

PF24195DUF7420128-160 aa

PF07047OPA3128-173 aa

PF27360UU048130-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G064720	`PF00139`	Lectin_legB	6	60	2.2e-13	51.0
TkA02G064720	`PF04341`	DUF485	48	60	0.12	13.1
TkA02G064720	`PF00139`	Lectin_legB	81	115	2.2e-13	51.0
TkA02G064720	`PF04341`	DUF485	87	101	0.12	13.1
TkA02G064720	`PF22812`	CR_prot_dom_plant	121	168	0.077	14.2
TkA02G064720	`PF24195`	DUF7420	128	160	0.029	15.3
TkA02G064720	`PF07047`	OPA3	128	173	0.031	14.8
TkA02G064720	`PF27360`	UU048	130	172	0.07	12.4
TkA02G064720	`PF08693`	SKG6	131	173	0.015	14.9
TkA02G064720	`PF04341`	DUF485	138	168	0.12	13.1
TkA02G064720	`PF05545`	FixQ	147	173	0.02	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXA5`	Arabidopsis thaliana	sp\|Q9LXA5\|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1	29.700%	Swiss-Prot	Low
`C0LGH2`	Arabidopsis thaliana	sp\|C0LGH2\|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130	32.800%	Swiss-Prot	Low
`Q8W4G6`	Arabidopsis thaliana	sp\|Q8W4G6\|CRK15_ARATH Cysteine-rich receptor-like protein kinase 15	35.900%	Swiss-Prot	Low
`Q9ZP16`	Arabidopsis thaliana	sp\|Q9ZP16\|CRK11_ARATH Cysteine-rich receptor-like protein kinase 11	33.100%	Swiss-Prot	Low
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	30.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card