TkA02G060470 | RubberDandelionOmics

Gene overview

TkA02G060470

Reference: TK1151 Chr: Chr02 Coordinates: 15776660-15783682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4245 bp · TkA02G060470|TK1151|cDNA

AAATCGAGAGCCTCCACTCCACTCCAGCCCTCCAACTCCATCGGCGACTCCAACCTCTCTATCCGTCATCGGCGACTCCAAGTCCTCCACCTCTCGTCGCCGGCGCTGACTCCGGCTTGAAAAGGTCGCACCACAGCTGCAGCAGGCTCTATCTTCGAACAGACATTTTATAAAGGTTGTATATCAATGGGGAGTAAGAAAAGGAGCTCTGATAGTGTAGAAGAAGTTGAGAACCAGAAGAGTACTAATTCAATCTCTGA...

CDS

Download CDS FASTA

3906 bp · TkA02G060470|TK1151|CDS

ATGGGGAGTAAGAAAAGGAGCTCTGATAGTGTAGAAGAAGTTGAGAACCAGAAGAGTACTAATTCAATCTCTGATACCAAAGTTTCGACTGAGCATTTGAAAAAGAAGATAAAAAAGGTGAAGAAGAACGAAGTGGAGAGTAATAATAATACAAGCTCTGATACCAAAGTTTCAAGTGAGCATTTGAAAAAGAAGATAAAAAAGGTGAAGAAGAACGAAGTGGAGATAGAAAAACCTAATGATAACGACAACAACTCCAA...

Protein

Download Protein FASTA

1301 aa · TkA02G060470|TK1151|PROTEIN

MGSKKRSSDSVEEVENQKSTNSISDTKVSTEHLKKKIKKVKKNEVESNNNTSSDTKVSSEHLKKKIKKVKKNEVEIEKPNDNDNNSNGVKPMERRKKRKALDKEKHRSTTSDDKPEVKPIVTSSEAKEAESRTSNGLPEFHIGVFKDLGSADGSVREAAAERLVMELQAVQKAYDVLEKKEDIDGGLKLEAEKDDGLNNCAPSLRYAVRRLIRGVSSSRECARQGFALGLTMLVGAVSDIALDSLLKLIIDLLEVSSSMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G060470`
TK1151 ID	TkA02G060470
OH-1004 ID	LXL04_017279
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 97.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G060470`
Location	Chr02:15776660-15783682 (+)
Description	Similar to pol5: rDNA transcriptional regulator pol5 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017279` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000027 ribosomal large subunit assembly Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0009303 rRNA transcription Biological Process GO:0022904 respiratory electron transport chain Biological Process GO:0032922 circadian regulation of gene expression Biological Process GO:0042149 cellular response to glucose starvation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process
KEGG gene cross-reference	hsa:10514 mmu:18432 rno:60571 sce:YEL055C spo:2539834 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA02G060470 · TK1151

Cytoplasm0.107

Rank 2 · TkA02G060470 · TK1151

Cell membrane0.029

Rank 3 · TkA02G060470 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA02G060470 · TK1151

Mitochondrion0.013

Rank 5 · TkA02G060470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04931DNA_pol_phi15-77 aa

PF00736EF1_GNE23-47 aa

PF26720TPR_Mybbp1a38-50 aa

PF00736EF1_GNE54-77 aa

PF04931DNA_pol_phi206-1013 aa

PF26720TPR_Mybbp1a542-586 aa

PF26720TPR_Mybbp1a977-1035 aa

PF04931DNA_pol_phi1056-1098 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G060470	`PF04931`	DNA_pol_phi	15	77	5.3e-177	591.1
TkA02G060470	`PF00736`	EF1_GNE	23	47	1.0	10.3
TkA02G060470	`PF26720`	TPR_Mybbp1a	38	50	0.065	13.1
TkA02G060470	`PF00736`	EF1_GNE	54	77	1.0	10.3
TkA02G060470	`PF04931`	DNA_pol_phi	206	1013	5.3e-177	591.1
TkA02G060470	`PF26720`	TPR_Mybbp1a	542	586	0.065	13.1
TkA02G060470	`PF26720`	TPR_Mybbp1a	977	1035	0.065	13.1
TkA02G060470	`PF04931`	DNA_pol_phi	1056	1098	5.3e-177	591.1
TkA02G060470	`PF26720`	TPR_Mybbp1a	1132	1211	0.065	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card