TkA02G060410 | RubberDandelionOmics

Gene overview

TkA02G060410

Reference: TK1151 Chr: Chr02 Coordinates: 15740631-15745304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2379 bp · TkA02G060410|TK1151|cDNA

CCCTCCCCACAACTCTTACTAGAAAATTCGGCCCTCTTTTTAAATCATTTCCCTGCGAAAACCCTAAACCCTTCCTTCTCAAAACCACTGGAACTTCAGCTCACTTCATCGATCGTCTCTCTCATTCACTGTTCGGTGTTCGATGGCGACCTACGCGTTGCTCAGATCTCTTCGTCGAAGAGACGTCTCATCTGCTCCTTTATCCGCCTTCAAATCCTTAAGTGGAGCCAAACCATCATGGGCTGGATCACATTTAAGTC...

CDS

Download CDS FASTA

1290 bp · TkA02G060410|TK1151|CDS

ATGGCGACCTACGCGTTGCTCAGATCTCTTCGTCGAAGAGACGTCTCATCTGCTCCTTTATCCGCCTTCAAATCCTTAAGTGGAGCCAAACCATCATGGGCTGGATCACATTTAAGTCACAAGATAAGCATGCTTTCCAGACCCTTCAGCTCAAGACCTCTAGGAAACGAAGTTATTGGTATTGACTTAGGTACAACAAACTCATGTGTTGCAGTCATGGAAGGAAAGACTGCAAAGGTGATTGAGAATTCAGAAGGATC...

Protein

Download Protein FASTA

429 aa · TkA02G060410|TK1151|PROTEIN

MATYALLRSLRRRDVSSAPLSAFKSLSGAKPSWAGSHLSHKISMLSRPFSSRPLGNEVIGIDLGTTNSCVAVMEGKTAKVIENSEGSRTTPSVVAFNQKGELIVGTPAKRQAVTNPTNTVFGTKRLIGRRFDDPQTQKEMQMVPYKIVKAPNGDAWVEANGQKYSPSQIGAFVLTKMKETAEAYLGKTINKAVITVPAYFNDAQRQATKDAGRIAGLDVERIINEPTAAALSYGLNNKEGLIAVFDLGGGTFDVSILEIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G060410`
TK1151 ID	TkA02G060410
OH-1004 ID	LXL04_017280
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 37.369 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G060410`
Location	Chr02:15740631-15745304 (+)
Description	Similar to Heat shock 70 kDa protein, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017280` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0009615 response to virus Biological Process GO:0016226 iron-sulfur cluster assembly Biological Process GO:0017004 cytochrome complex assembly Biological Process GO:0042026 protein refolding Biological Process GO:0140964 intracellular auxin homeostasis Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT4G37910 ath:AT5G09590 sot:102582209 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.937

Rank 1 · TkA02G060410 · TK1151

Cytoplasm0.079

Rank 2 · TkA02G060410 · TK1151

Nucleus0.055

Rank 3 · TkA02G060410 · TK1151

Plastid0.030

Rank 4 · TkA02G060410 · TK1151

Cell membrane0.026

Rank 5 · TkA02G060410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP7058-425 aa

PF06723MreB_Mbl58-110 aa

PF14450FtsA60-78 aa

PF06723MreB_Mbl188-422 aa

PF14450FtsA244-409 aa

PF25223DUF7841276-328 aa

PF01031Dynamin_M338-406 aa

PF02782FGGY_C364-424 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G060410	`PF00012`	HSP70	58	425	1.6e-184	615.2
TkA02G060410	`PF06723`	MreB_Mbl	58	110	1.9e-13	50.7
TkA02G060410	`PF14450`	FtsA	60	78	0.00059	20.9
TkA02G060410	`PF06723`	MreB_Mbl	188	422	1.9e-13	50.7
TkA02G060410	`PF14450`	FtsA	244	409	0.00059	20.9
TkA02G060410	`PF25223`	DUF7841	276	328	0.18	12.7
TkA02G060410	`PF01031`	Dynamin_M	338	406	0.056	13.3
TkA02G060410	`PF02782`	FGGY_C	364	424	0.26	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card