TkA02G057190 | RubberDandelionOmics

Gene overview

TkA02G057190

Reference: TK1151 Chr: Chr02 Coordinates: 14928847-14930467 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

919 bp · TkA02G057190|TK1151|cDNA

ACCACGGTTGAACTCCAAATCACCCCTGTTTCTTGCTATAAATACCGAAGCCCTAGGATTTTGAAACGCATCAGTTTGCATCTGAAGGCGTCTTGATAAACGCCTTTTGATCCTGAGTGATATTCGCAACCAGTTCCTCAAATTTCAACTTTCATCTTCTCAAGTCAATTCATCTGCGAAAATGAGAGAGTGCATCTCGATTCACATCGGTCAGGCCGGTATTCAGGTCGGAAATGCGTGCTGGGAACTTTACTGCCTCG...

CDS

Download CDS FASTA

738 bp · TkA02G057190|TK1151|CDS

ATGAGAGAGTGCATCTCGATTCACATCGGTCAGGCCGGTATTCAGGTCGGAAATGCGTGCTGGGAACTTTACTGCCTCGAGCATGGCATTCAGCCCGATGGTCAGATGCCCAGTGATAAGACAGTCGGAGGAGGCGACGACGCATTCAACACCTTTTTCAGCGAAACTGGTGCCGGAAAGCACGTCCCTCGCGCCGTCTTCGTCGATCTTGAGCCTACCGTCATAGACGAAGTCAGAACTGGAACCTACCGTCAGTTTCC...

Protein

Download Protein FASTA

245 aa · TkA02G057190|TK1151|PROTEIN

MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQFPFHPEQLISAKRRRQQLRFARGHYTIGKEIVDLCLDRIRKLAPTTAPVSKASSSSTPSVAEPAPVSAPSSSSVSPLTTEKIKTRIHRLPISPSNLLSHRLPPLRRCSQRRRHRIPNQSRPLPPHPFHALLLRSRHLRRKSLPRTSPSPKSPTAPSNLLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G057190`
TK1151 ID	TkA02G057190
OH-1004 ID	LXL04_038517
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 52.245 / OH-1004 27.876 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G057190

Location Chr02:14928847-14930467 (+)

Description Similar to TUBA: Tubulin alpha chain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50010`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release
`At1g04820`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release
`At4g14960`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038517 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0071258 cellular response to gravity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G04820

ath:AT1G50010

ath:AT4G14960

ghi:107898755

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.606

Rank 1 · TkA02G057190 · TK1151

Cytoplasm0.380

Rank 2 · TkA02G057190 · TK1151

Mitochondrion0.066

Rank 3 · TkA02G057190 · TK1151

Cell membrane0.039

Rank 4 · TkA02G057190 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA02G057190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00091Tubulin3-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G057190	`PF00091`	Tubulin	3	128	2.3e-26	94.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGT7`	Arabidopsis thaliana	sp\|B9DGT7\|TBA2_ARATH Tubulin alpha-2 chain	92.200%	Swiss-Prot	Medium
`Q0WV25`	Arabidopsis thaliana	sp\|Q0WV25\|TBA4_ARATH Tubulin alpha-4 chain	92.200%	Swiss-Prot	Medium
`P29511`	Arabidopsis thaliana	sp\|P29511\|TBA6_ARATH Tubulin alpha-6 chain	91.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card