LXL04_038517 | RubberDandelionOmics

Gene overview

LXL04_038517

Reference: OH-1004 Chr: Chr09 Coordinates: 43040001-43042330 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_038517|LXL04_038517|OH1004|cDNA

ATGAGAGAGTGCATCTCGATCCACATCGGTCAGGCCGGCATTCAGGTCGGAAACGCCTGCTGGGAACTTTACTGCCTCGAGCATGGCATTCAGCCCGATGGCCAGATGCCAAGTGACAAAACCGTCGGAGGAGGTGACGACGCTTTTAACACCTTCTTCAGTGAAACTGGCGCCGGAAAACACGTCCCTCGCGCCGTTTTTGTAGATCTGGAACCCACCGTCATCGACGAAGTAAGAACCGGAACCTACCGTCAACTCTT...

CDS

Download CDS FASTA

1359 bp · LXL04_038517|LXL04_038517|OH1004|CDS

ATGAGAGAGTGCATCTCGATCCACATCGGTCAGGCCGGCATTCAGGTCGGAAACGCCTGCTGGGAACTTTACTGCCTCGAGCATGGCATTCAGCCCGATGGCCAGATGCCAAGTGACAAAACCGTCGGAGGAGGTGACGACGCTTTTAACACCTTCTTCAGTGAAACTGGCGCCGGAAAACACGTCCCTCGCGCCGTTTTTGTAGATCTGGAACCCACCGTCATCGACGAAGTAAGAACCGGAACCTACCGTCAACTCTT...

Protein

Download Protein FASTA

452 aa · LXL04_038517|LXL04_038517|OH1004|PROTEIN

MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038517`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038517

Location Chr09:43040001-43042330 (+)

Description Similar to TUBA: Tubulin alpha chain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04820`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release
`At1g50010`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release
`At4g14960`	Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038517 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0071258 cellular response to gravity Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G04820

ath:AT1G50010

ath:AT4G14960

ghi:107898755

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.758

Rank 1 · LXL04_038517 · OH-1004

Mitochondrion0.136

Rank 2 · LXL04_038517 · OH-1004

Nucleus0.095

Rank 3 · LXL04_038517 · OH-1004

Cell membrane0.035

Rank 4 · LXL04_038517 · OH-1004

Golgi apparatus0.034

Rank 5 · LXL04_038517 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00091.32Tubulin3-213 aa

PF03953.23Tubulin_C263-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038517	`PF00091.32`	Tubulin	3	213	4.1e-63	213.8
LXL04_038517	`PF03953.23`	Tubulin_C	263	392	3.7e-51	173.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WV25`	Arabidopsis thaliana	Tubulin alpha-4 chain	97.345%	Swiss-Prot	strong database homology
`B9DGT7`	Arabidopsis thaliana	Tubulin alpha-2 chain	97.345%	Swiss-Prot	strong database homology
`P29511`	Arabidopsis thaliana	Tubulin alpha-6 chain	97.124%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card