TkA02G037140 | RubberDandelionOmics

Gene overview

TkA02G037140

Reference: TK1151 Chr: Chr02 Coordinates: 9326537-9329074 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2166 bp · TkA02G037140|TK1151|cDNA

ATGTCGATCCTTCTCTTTCTTCTCTTCTCTAGCACAATCGCCACCGTCTCTGCCATCATCGCAACCGCTCCGGCCAAATCTGATTCATTTACACCTCCCGATAACTACCTCCTCGACTGCGGTTCCTCCTCCCAGACGATCCTCCCTGATAGACGCATATTTTCTTCCGATTCCACCTCATCACAGTATCTGCAATACAGTGGCCGTGAAATCTCCGTCGCTGATCAGTCCGCCGATGTGCCTCTCTCGATTTACAAAAC...

CDS

Download CDS FASTA

2166 bp · TkA02G037140|TK1151|CDS

ATGTCGATCCTTCTCTTTCTTCTCTTCTCTAGCACAATCGCCACCGTCTCTGCCATCATCGCAACCGCTCCGGCCAAATCTGATTCATTTACACCTCCCGATAACTACCTCCTCGACTGCGGTTCCTCCTCCCAGACGATCCTCCCTGATAGACGCATATTTTCTTCCGATTCCACCTCATCACAGTATCTGCAATACAGTGGCCGTGAAATCTCCGTCGCTGATCAGTCCGCCGATGTGCCTCTCTCGATTTACAAAAC...

Protein

Download Protein FASTA

721 aa · TkA02G037140|TK1151|PROTEIN

MSILLFLLFSSTIATVSAIIATAPAKSDSFTPPDNYLLDCGSSSQTILPDRRIFSSDSTSSQYLQYSGREISVADQSADVPLSIYKTAKVFDCEATYSFRVTKPGWHWLRLHFFPIGNNEFKLQETKFTVVAADTLVLLHRYSPKGLEMQEYIMNVTSERLNLRFCGKKAAPAFVNAIEVVSAPDMIITDTSDALFPVGKKIHGMSKYSYQKMYRLNVGGPTVTPGNDTLGRTWISDEKFLKPPSATKNISLAPNVVTYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G037140`
TK1151 ID	TkA02G037140
OH-1004 ID	LXL04_017516
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.200
Protein coverage (%)	TK1151 100.000 / OH-1004 46.659 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G037140

Location Chr02:9326537-9329074 (-)

Description Similar to At4g39110: Probable receptor-like protein kinase At4g39110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017516 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0009555 pollen development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0035563 positive regulation of chromatin binding Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0070828 heterochromatin organization Biological Process

GO:0071360 cellular response to exogenous dsRNA Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

KEGG gene cross-reference

ath:AT2G16390

ath:AT2G21480

ath:AT4G39110

ath:AT5G54380

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.773

Rank 1 · TkA02G037140 · TK1151

Endoplasmic reticulum0.101

Rank 2 · TkA02G037140 · TK1151

Cytoplasm0.083

Rank 3 · TkA02G037140 · TK1151

Lysosome / Vacuole0.062

Rank 4 · TkA02G037140 · TK1151

Nucleus0.050

Rank 5 · TkA02G037140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819Malectin_like38-387 aa

PF11721Malectin49-137 aa

PF11721Malectin304-353 aa

PF00069Pkinase504-531 aa

PF07714PK_Tyr_Ser-Thr505-535 aa

PF00069Pkinase535-641 aa

PF07714PK_Tyr_Ser-Thr541-643 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G037140	`PF12819`	Malectin_like	38	387	1.3e-23	84.5
TkA02G037140	`PF11721`	Malectin	49	137	5.9e-07	30.4
TkA02G037140	`PF11721`	Malectin	304	353	5.9e-07	30.4
TkA02G037140	`PF00069`	Pkinase	504	531	2.2e-08	34.5
TkA02G037140	`PF07714`	PK_Tyr_Ser-Thr	505	535	2.6e-08	34.2
TkA02G037140	`PF00069`	Pkinase	535	641	2.2e-08	34.5
TkA02G037140	`PF07714`	PK_Tyr_Ser-Thr	541	643	2.6e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T020`	Arabidopsis thaliana	sp\|Q9T020\|Y4391_ARATH Probable receptor-like protein kinase At4g39110	49.000%	Swiss-Prot	Medium
`Q9SJT0`	Arabidopsis thaliana	sp\|Q9SJT0\|Y2214_ARATH Probable receptor-like protein kinase At2g21480	48.000%	Swiss-Prot	Medium
`Q9FLJ8`	Arabidopsis thaliana	sp\|Q9FLJ8\|Y5613_ARATH Probable receptor-like protein kinase At5g61350	43.200%	Swiss-Prot	Medium
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	36.800%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card