LXL04_017516 | RubberDandelionOmics

Gene overview

LXL04_017516

Reference: OH-1004 Chr: Chr03 Coordinates: 152350174-152357720 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5436 bp · LXL04_017516|LXL04_017516|OH1004|cDNA

ATGTCGATCCTTCTctttcttctcttctctagcACAATCGCCACCGTCTCTGCCATCATCGCAACCGCTCCGGCCAAATCTGATTCATTTACACCTCCCGATAACTACCTCCTCGACTGCGGTTCCTCCTCCCAGACGATCCTCCCTGATAGACGCATATTTTCTTCCGATTCCACCTCATCACAGTATCTGCAATACAGTGGCCGTGAAATCTCCGTCGCTGATCAGTCCGCCGATGTGCCTCTCTCGATTTACAAAAC...

CDS

Download CDS FASTA

5436 bp · LXL04_017516|LXL04_017516|OH1004|CDS

ATGTCGATCCTTCTCTTTCTTCTCTTCTCTAGCACAATCGCCACCGTCTCTGCCATCATCGCAACCGCTCCGGCCAAATCTGATTCATTTACACCTCCCGATAACTACCTCCTCGACTGCGGTTCCTCCTCCCAGACGATCCTCCCTGATAGACGCATATTTTCTTCCGATTCCACCTCATCACAGTATCTGCAATACAGTGGCCGTGAAATCTCCGTCGCTGATCAGTCCGCCGATGTGCCTCTCTCGATTTACAAAAC...

Protein

Download Protein FASTA

1811 aa · LXL04_017516|LXL04_017516|OH1004|PROTEIN

MSILLFLLFSSTIATVSAIIATAPAKSDSFTPPDNYLLDCGSSSQTILPDRRIFSSDSTSSQYLQYSGREISVADQSADVPLSIYKTAKVFDCEATYSFRVTKPGWHWLRLHFFPIGNNEFKLQETKFTVVAADTLVLLHRYSPKGLEMQEYIMNVTSERLNLRFCGKKAAPAFVNAIEVVSAPDMIITDTSDALFPVGKKIHGMSKYSYQKMYRLNVGGPTVTPGNDTLGRTWISDEKFLKPPSATKNISLAPNVVTYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017516`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017516

Location Chr03:152350174-152357720 (+)

Description Similar to At4g39110: Probable receptor-like protein kinase At4g39110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At2g16390`	Subunit of the chromatin-remodeling complex (DDR complex) that mediates RNA polymerases IV and V (Pol IV and Pol V) recruitment to chromatin.	Atypical RNA polymerase subunits required for RNA-directed DNA methylation.2005 · DOI: 10.1038/ng1580 A SNF2-like protein facilitates dynamic control of DNA methylation.2005 · DOI: 10.1038/sj.embor.7400446 Endogenous targets of RNA-directed DNA methylation and Pol IV in Arabidopsis.2006 · DOI: 10.1038/sj.emboj.7601150 RNAi, DRD1, and histone methylation actively target developmentally important non-CG DNA methylation in arabidopsis.2006 · DOI: 10.1371/journal.pgen.0020083 A structural-maintenance-of-chromosomes hinge domain-containing protein is required for RNA-directed DNA methylation.2008 · DOI: 10.1038/ng.119 Noncoding transcription by RNA polymerase Pol IVb/Pol V mediates transcriptional silencing of overlapping and adjacent genes.2008 · DOI: 10.1016/j.cell.2008.09.035 NRPD4, a protein related to the RPB4 subunit of RNA polymerase II, is a component of RNA polymerases IV and V and is required for RNA-directed DNA methylation.2009 · DOI: 10.1101/gad.1765209 Defining the functional network of epigenetic regulators in Arabidopsis thaliana.2009 · DOI: 10.1093/mp/ssp017 RNA polymerase V functions in Arabidopsis interphase heterochromatin organization independently of the 24-nt siRNA-directed DNA methylation pathway.2009 · DOI: 10.1093/mp/ssp006 The RNA silencing enzyme RNA polymerase v is required for plant immunity.2011 · DOI: 10.1371/journal.pgen.1002434 RNA polymerase V-dependent small RNAs in Arabidopsis originate from small, intergenic loci including most SINE repeats.2012 · DOI: 10.4161/epi.20290 The Arabidopsis nucleosome remodeler DDM1 allows DNA methyltransferases to access H1-containing heterochromatin.2013 · DOI: 10.1016/j.cell.2013.02.033
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017516 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0009555 pollen development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0035563 positive regulation of chromatin binding Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0070828 heterochromatin organization Biological Process

GO:0071360 cellular response to exogenous dsRNA Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

KEGG gene cross-reference

ath:AT2G16390

ath:AT2G21480

ath:AT4G39110

ath:AT5G54380

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.282

Rank 1 · LXL04_017516 · OH-1004

Cell membrane0.280

Rank 2 · LXL04_017516 · OH-1004

Endoplasmic reticulum0.169

Rank 3 · LXL04_017516 · OH-1004

Cytoplasm0.114

Rank 4 · LXL04_017516 · OH-1004

Golgi apparatus0.104

Rank 5 · LXL04_017516 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like38-387 aa

PF11721.15Malectin304-353 aa

PF00069.32Pkinase504-764 aa

PF07714.24PK_Tyr_Ser-Thr505-767 aa

PF04851.22ResIII1264-1441 aa

PF00176.30SNF2-rel_dom1269-1558 aa

PF00271.38Helicase_C1619-1734 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017516	`PF12819.14`	Malectin_like	38	387	6.5e-23	82.2
LXL04_017516	`PF11721.15`	Malectin	304	353	5e-06	27.4
LXL04_017516	`PF00069.32`	Pkinase	504	764	1.7e-41	143.1
LXL04_017516	`PF07714.24`	PK_Tyr_Ser-Thr	505	767	7e-46	157.3
LXL04_017516	`PF04851.22`	ResIII	1264	1441	2.1e-08	35.0
LXL04_017516	`PF00176.30`	SNF2-rel_dom	1269	1558	1.1e-24	87.8
LXL04_017516	`PF00271.38`	Helicase_C	1619	1734	6.3e-13	49.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T020`	Arabidopsis thaliana	Probable receptor-like protein kinase At4g39110	61.825%	Swiss-Prot	weak database homology
`Q9SJT0`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g21480	58.968%	Swiss-Prot	weak database homology
`Q9SIW2`	Arabidopsis thaliana	Protein CHROMATIN REMODELING 35	51.551%	Swiss-Prot	moderate database homology
`Q9FLJ8`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g61350	55.767%	Swiss-Prot	weak database homology
`Q9LK35`	Arabidopsis thaliana	Receptor-like protein kinase THESEUS 1	47.344%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card