TkA02G035800 | RubberDandelionOmics

Gene overview

TkA02G035800

Reference: TK1151 Chr: Chr02 Coordinates: 8917331-8922505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2317 bp · TkA02G035800|TK1151|cDNA

TATAAACATCTTTTGCTTTCATCACTTCACGAGCTTTAATTTAAACAATTTCAAATTTCAACTCAATAGTTTTTTTAACACTTATTTACCGAATTTGCGGTATATATACATCCAGAAATGGAGACATATACACTTGCAAACACCAGATTTCTCGTGACAGAGCTCACAAGCCAATAAATCACCACCGTTCACGCATTTCCACAGATTAAAATTCACAGCTTTTACAACTCTATTTTTTGCATAATCACCCAATTGGGTAT...

CDS

Download CDS FASTA

1521 bp · TkA02G035800|TK1151|CDS

ATGATGGGTTTTTTGAGTGGGGAGAAGATCAGAGGGAGCTTAAACGGCACCGTTTGGGTTAACCATTTGCGAAAAAAGTTGAGTTTTCAAAAGCGAAATAGCAAAATTACAAAACCTGGTGTTGCTTACTCTGTTATCACGTCAAATAATGGCCATGAAACCATGGTTGAGAAACTTGCGCCACCGATATTTGAGCGGAGGAGGGTAAATCCGAAAAATGTGGCGGCGATCATACTCGGCGGTGGTGCCGGAACGCATCT...

Protein

Download Protein FASTA

506 aa · TkA02G035800|TK1151|PROTEIN

MMGFLSGEKIRGSLNGTVWVNHLRKKLSFQKRNSKITKPGVAYSVITSNNGHETMVEKLAPPIFERRRVNPKNVAAIILGGGAGTHLFPLTSKTATPAVPVGGCYRLIDIPMSNCINSTINKIFVLTQFNSASLNRHIARTYYGNGVNFGDGFVEVLAATQTPGEAGMNWFQGTADAVRQFTWVFEDAKNKDIEDILILSGDHLYRMDYLNLLQNHMDRDADITVSCVPVGESRASDFGLLKFDNKGQVLQFAEKPKDDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G035800`
TK1151 ID	TkA02G035800
OH-1004 ID	LXL04_017496
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.605 / OH-1004 94.915 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G035800

Location Chr02:8917331-8922505 (+)

Description Similar to AGPS1: Glucose-1-phosphate adenylyltransferase large subunit 1 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39210`	This protein plays a role in synthesis of starch.	No verified direct reference in this release
`At2g21590`	This protein plays a role in synthesis of starch.	No verified direct reference in this release
`At1g27680`	This protein plays a role in synthesis of starch.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010170 glucose-1-phosphate adenylyltransferase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008878 glucose-1-phosphate adenylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G27680

ath:AT2G21590

ath:AT4G39210

bvg:104889614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.932

Rank 1 · TkA02G035800 · TK1151

Mitochondrion0.084

Rank 2 · TkA02G035800 · TK1151

Cytoplasm0.052

Rank 3 · TkA02G035800 · TK1151

Peroxisome0.036

Rank 4 · TkA02G035800 · TK1151

Nucleus0.023

Rank 5 · TkA02G035800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483NTP_transferase76-352 aa

PF25247LbH_GLGC371-505 aa

PF24894Hexapep_GlmU372-433 aa

PF25087GMPPB_C379-425 aa

PF25084LbH_EIF2B380-424 aa

PF00132Hexapep385-394 aa

PF24894Hexapep_GlmU431-469 aa

PF25084LbH_EIF2B445-471 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G035800	`PF00483`	NTP_transferase	76	352	1.2e-69	235.3
TkA02G035800	`PF25247`	LbH_GLGC	371	505	2.9e-54	183.4
TkA02G035800	`PF24894`	Hexapep_GlmU	372	433	1.1e-08	35.9
TkA02G035800	`PF25087`	GMPPB_C	379	425	1.3e-06	28.8
TkA02G035800	`PF25084`	LbH_EIF2B	380	424	4.6e-06	27.3
TkA02G035800	`PF00132`	Hexapep	385	394	0.019	15.4
TkA02G035800	`PF24894`	Hexapep_GlmU	431	469	1.1e-08	35.9
TkA02G035800	`PF25084`	LbH_EIF2B	445	471	4.6e-06	27.3
TkA02G035800	`PF00132`	Hexapep	446	469	0.019	15.4
TkA02G035800	`PF25087`	GMPPB_C	451	505	1.3e-06	28.8
TkA02G035800	`PF00132`	Hexapep	493	506	0.019	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55231`	Arabidopsis thaliana	sp\|P55231\|GLGL3_ARATH Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic	70.000%	Swiss-Prot	High
`Q9SIK1`	Arabidopsis thaliana	sp\|Q9SIK1\|GLGL4_ARATH Probable glucose-1-phosphate adenylyltransferase large subunit, chloroplastic	72.600%	Swiss-Prot	High
`P55230`	Arabidopsis thaliana	sp\|P55230\|GLGL2_ARATH Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card