TkA02G019860 | RubberDandelionOmics

Gene overview

TkA02G019860

Reference: TK1151 Chr: Chr02 Coordinates: 4646570-4652918 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA02G019860|TK1151|cDNA

ATGTCAGAATATTGTTTTAGATCTGCTATACCACCATCCCCGACAACCATCAAAATCCAGAATACAATGTCTTTTCTCGATCCATCCATGGAAGACTTACCTATAGAAGTCATGAATGATATTCTCTCAAGACTTCCTGTCAAAACTATCATCCATTGCAAGTTTGTATGCAAGAAGTGGCTCGATCTCGTTTCAGATTCGTACTTTGCCAAATTTCACCTCTCGAGATCACCTGCAGGCATCATGATTCATCATATTTC...

CDS

Download CDS FASTA

909 bp · TkA02G019860|TK1151|CDS

ATGTCAGAATATTGTTTTAGATCTGCTATACCACCATCCCCGACAACCATCAAAATCCAGAATACAATGTCTTTTCTCGATCCATCCATGGAAGACTTACCTATAGAAGTCATGAATGATATTCTCTCAAGACTTCCTGTCAAAACTATCATCCATTGCAAGTTTGTATGCAAGAAGTGGCTCGATCTCGTTTCAGATTCGTACTTTGCCAAATTTCACCTCTCGAGATCACCTGCAGGCATCATGATTCATCATATTTC...

Protein

Download Protein FASTA

302 aa · TkA02G019860|TK1151|PROTEIN

MSEYCFRSAIPPSPTTIKIQNTMSFLDPSMEDLPIEVMNDILSRLPVKTIIHCKFVCKKWLDLVSDSYFAKFHLSRSPAGIMIHHISKKEMAEGPFTPGILKLVEVEDELDHHHLHHDPSMSLDLNLAPLFQKSKTFMTGSVDGLICMLQYYPESDNTYICNPITREYMILPNQKYYKEENYLTVNYGFGVGLVTKKYKVIRTILRDMSSSRLEAEVYTLGSGQWIRLGHVPYWINEFNGPFLNGHAHWPASGSGSGSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G019860`
TK1151 ID	TkA02G019860
OH-1004 ID	LXL04_017637
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.400
Protein coverage (%)	TK1151 99.007 / OH-1004 72.705 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G019860

Location Chr02:4646570-4652918 (-)

Description Similar to At3g07870: F-box protein At3g07870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At3g10240`	Putative F-box protein At3g10240.	No verified direct reference in this release
`At2g43260`	F-box/LRR-repeat protein At2g43260.	No verified direct reference in this release
`At3g16740`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017637 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G30920

ath:AT3G06240

ath:AT3G07870

ath:AT3G23880

ath:AT5G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · TkA02G019860 · TK1151

Nucleus0.416

Rank 2 · TkA02G019860 · TK1151

Cell membrane0.144

Rank 3 · TkA02G019860 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA02G019860 · TK1151

Lysosome / Vacuole0.046

Rank 5 · TkA02G019860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like30-68 aa

PF00646F-box31-69 aa

PF29466F-box_COS11131-75 aa

PF24750b-prop_At3g26010-like48-64 aa

PF07734FBA_1118-292 aa

PF08268FBA_3130-291 aa

PF24750b-prop_At3g26010-like130-252 aa

PF03478Beta-prop_KIB1-4134-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G019860	`PF12937`	F-box-like	30	68	3.4e-09	37.0
TkA02G019860	`PF00646`	F-box	31	69	3.6e-11	43.2
TkA02G019860	`PF29466`	F-box_COS111	31	75	0.072	14.4
TkA02G019860	`PF24750`	b-prop_At3g26010-like	48	64	1.6e-07	31.5
TkA02G019860	`PF07734`	FBA_1	118	292	1.4e-16	61.1
TkA02G019860	`PF08268`	FBA_3	130	291	4.7e-16	59.4
TkA02G019860	`PF24750`	b-prop_At3g26010-like	130	252	1.6e-07	31.5
TkA02G019860	`PF03478`	Beta-prop_KIB1-4	134	178	0.049	13.9
TkA02G019860	`PF04360`	Serglycin	252	269	0.0043	17.8
TkA02G019860	`PF00646`	F-box	286	300	3.6e-11	43.2
TkA02G019860	`PF12937`	F-box-like	286	300	3.4e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	23.600%	Swiss-Prot	Low
`Q9SS35`	Arabidopsis thaliana	sp\|Q9SS35\|FB137_ARATH Putative F-box protein At3g10240	26.400%	Swiss-Prot	Low
`Q8S8Q9`	Arabidopsis thaliana	sp\|Q8S8Q9\|FBL40_ARATH F-box/LRR-repeat protein At2g43260	23.900%	Swiss-Prot	Low
`Q9LUQ9`	Arabidopsis thaliana	sp\|Q9LUQ9\|FBK56_ARATH F-box/kelch-repeat protein At3g16740	26.400%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	26.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card