TkA01G638640 | RubberDandelionOmics

Gene overview

TkA01G638640

Reference: TK1151 Chr: Chr01 Coordinates: 161632603-161635417 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA01G638640|TK1151|cDNA

ATGGATCTCGAGGGAGGCTCGCAGTTGTGGCCGGTGAAAGGGACGCTGGTCTCGATGGTGATGGTAGTGGACTTCGTGGGCCAAGTTGGAACGTTGTATTTGGTAGAAGGGATTCGACAACAGCAAGCCAAAGTGCTGCGAATTCTAACCTTCCTTCACCAACTTCAAGAGCTCATACTATTGGTCAAGCAAGGATTGAGATCCAATTGTCCATCGAGTGGTGGCGACAACAATCTGTCTCCATTAGATTCCTCAGCTAC...

CDS

Download CDS FASTA

441 bp · TkA01G638640|TK1151|CDS

ATGGATCTCGAGGGAGGCTCGCAGTTGTGGCCGGTGAAAGGGACGCTGGTCTCGATGGTGATGGTAGTGGACTTCGTGGGCCAAGTTGGAACGTTGTATTTGGTAGAAGGGATTCGACAACAGCAAGCCAAAGTGCTGCGAATTCTAACCTTCCTTCACCAACTTCAAGAGCTCATACTATTGGTCAAGCAAGGATTGAGATCCAATTGTCCATCGAGTGGTGGCGACAACAATCTGTCTCCATTAGATTCCTCAGCTAC...

Protein

Download Protein FASTA

146 aa · TkA01G638640|TK1151|PROTEIN

MDLEGGSQLWPVKGTLVSMVMVVDFVGQVGTLYLVEGIRQQQAKVLRILTFLHQLQELILLVKQGLRSNCPSSGGDNNLSPLDSSATAFDNRFYSDLINQRGLLHSDQELFNGGSTDAQVQSYSSNGATFSTDFANARVKMATLTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G638640`
TK1151 ID	TkA01G638640
OH-1004 ID	LXL04_000053
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.600
Protein coverage (%)	TK1151 39.726 / OH-1004 18.650 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G638640`
Location	Chr01:161632603-161635417 (-)
Description	Similar to PNC1: Cationic peroxidase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000053` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006979 response to oxidative stress Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0010089 xylem development Biological Process GO:0042744 hydrogen peroxide catabolic process Biological Process GO:1901430 positive regulation of syringal lignin biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0048046 apoplast Cellular Component GO:0004601 peroxidase activity Molecular Function GO:0020037 heme binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ahf:112743807 ath:AT5G05340 zma:100125639 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.554

Rank 1 · TkA01G638640 · TK1151

Cytoplasm0.369

Rank 2 · TkA01G638640 · TK1151

Cell membrane0.075

Rank 3 · TkA01G638640 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA01G638640 · TK1151

Mitochondrion0.066

Rank 5 · TkA01G638640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase62-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G638640	`PF00141`	peroxidase	62	126	1.7e-11	45.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card