RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G627310
Reference: TK1151 Chr: Chr01 Coordinates: 158374528-158377534 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2868 bp · TkA01G627310|TK1151|cDNA

GCCCCTACACTTACGGTATCTGCATAAATGAACCACAAATAAGAATGAAAATCCCCTATCAAACAACAAAAATTCAAACAATAGTCGGTCTGGCTAAAACCCTCGCTGCCTCGCCCACAGAAACTGTATTTTCCAGAAACAAGGGGATGAGTTTTGATCGATTACCGCTCGCTTCCATCGAAGATGAAGACCAAGAATTCGAGGAATCATCGTCGTCTACTCCGGCAACCCAGTCTGAAACATTTATGGTGGGTTTCATG...

CDS

Download CDS FASTA

2607 bp · TkA01G627310|TK1151|CDS

ATGAAAATCCCCTATCAAACAACAAAAATTCAAACAATAGTCGGTCTGGCTAAAACCCTCGCTGCCTCGCCCACAGAAACTGTATTTTCCAGAAACAAGGGGATGAGTTTTGATCGATTACCGCTCGCTTCCATCGAAGATGAAGACCAAGAATTCGAGGAATCATCGTCGTCTACTCCGGCAACCCAGTCTGAAACATTTATGGTGGGTTTCATGGTCGCAAACATTGTCGGTCTGCAATACTATCGCGGCCGGATAAG...

Protein

Download Protein FASTA

868 aa · TkA01G627310|TK1151|PROTEIN

MKIPYQTTKIQTIVGLAKTLAASPTETVFSRNKGMSFDRLPLASIEDEDQEFEESSSSTPATQSETFMVGFMVANIVGLQYYRGRISGREMVGLVREPLNAYDSNAIKVVNTRTIQVGHIEKKVASVLAPLLDSNFVHVEGIVPKTPKSAAAYRIPCHIHVFSKMEAFETVKSALRSFLFTPNDPMFSMSDSMVVKEKKKGDLDEIFKLVDDNLRENAVNGVMEPPQDFILPDLFQHQKEGLYWLHHRENSDELPPFWEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G627310
TK1151 IDTkA01G627310
OH-1004 IDLXL04_000221
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G627310
LocationChr01:158374528-158377534 (+)
DescriptionSimilar to At5g05130: Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g05130 Possesses intrinsic ATP-dependent nucleosome-remodeling activity. No verified direct reference in this release
At5g22750 Functions in error-free postreplication DNA repair or DNA- damage tolerance (DTT) pathway.
A homolog of ScRAD5 is involved in DNA repair and homologous recombination in Arabidopsis.2008 · DOI: 10.1104/pp.108.116806
RAD5A, RECQ4A, and MUS81 have specific functions in homologous recombination and define different pathways of DNA repair in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.078568
RAD5a and REV3 function in two alternative pathways of DNA-damage tolerance in Arabidopsis.2011 · DOI: 10.1016/j.dnarep.2011.04.009
AtRAD5A is a DNA translocase harboring a HIRAN domain which confers binding to branched DNA structures and is required for DNA repair in vivo.2016 · DOI: 10.1111/tpj.13283

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000209 protein polyubiquitination Biological Process
GO:0006281 DNA repair Biological Process
GO:0006325 chromatin organization Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006974 DNA damage response Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0042789 mRNA transcription by RNA polymerase II Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process
GO:0070534 protein K63-linked ubiquitination Biological Process
GO:0071168 protein localization to chromatin Biological Process
GO:0071932 replication fork reversal Biological Process
GO:0141119 chromosomal DNA methylation maintenance following DNA replication Biological Process
KEGG gene cross-reference
ath:AT5G05130
hsa:6596
mmu:20585
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.806
Rank 1 · TkA01G627310 · TK1151
Cytoplasm0.204
Rank 2 · TkA01G627310 · TK1151
Mitochondrion0.034
Rank 3 · TkA01G627310 · TK1151
Cell membrane0.031
Rank 4 · TkA01G627310 · TK1151
Endoplasmic reticulum0.022
Rank 5 · TkA01G627310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08797HIRAN70-163 aa
PF00176SNF2-rel_dom237-593 aa
PF04851ResIII281-304 aa
PF00270DEAD290-465 aa
PF04851ResIII356-467 aa
PF13920zf-C3HC4_3589-597 aa
PF04423Rad50_zn_hook617-638 aa
PF11789zf-Nse627-671 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G627310PF08797HIRAN701631.5e-2176.7
TkA01G627310PF00176SNF2-rel_dom2375932e-71241.2
TkA01G627310PF04851ResIII2813048.1e-0626.5
TkA01G627310PF00270DEAD2904655.9e-0626.8
TkA01G627310PF04851ResIII3564678.1e-0626.5
TkA01G627310PF13920zf-C3HC4_35895971.1e-0732.2
TkA01G627310PF04423Rad50_zn_hook6176380.3511.4
TkA01G627310PF11789zf-Nse6276710.07713.5
TkA01G627310PF13920zf-C3HC4_36306771.1e-0732.2
TkA01G627310PF13639zf-RING_26326725.1e-0833.8
TkA01G627310PF12678zf-rbx16326720.0003421.5
TkA01G627310PF17123zf-RING_116326571.59.3
TkA01G627310PF00097zf-C3HC46336712.2e-0731.3
TkA01G627310PF13923zf-C3HC4_26336712.5e-0731.1
TkA01G627310PF14634zf-RING_56336725.1e-0730.3
TkA01G627310PF12861zf-ANAPC116336740.0001522.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FF61Arabidopsis thalianasp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 159.600%Swiss-ProtHigh
Q9FNI6Arabidopsis thalianasp|Q9FNI6|SM3L2_ARATH DNA repair protein RAD5A36.300%Swiss-ProtMedium

JBrowse

View in Genome Browser