TkA01G624280 | RubberDandelionOmics

Gene overview

TkA01G624280

Reference: TK1151 Chr: Chr01 Coordinates: 157602669-157604869 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1634 bp · TkA01G624280|TK1151|cDNA

ATGGATAATTCTCTCCCCTGCCTATAAATATATGTACTCCAAACATTTTACTTAGGACACACAATCCTCTTCAAGTGTTTTCCTCTCTTTTACAACAGTTTTCTAACTTAAAAACCCTACTCTTCTCATCTCTAAGTCACCAAAAACAAGAAAAAATGGAAGGAAAATTAGGATGTTTTGCGAGGTTTTTTCTCACGGCCAAACCATATATTGCCATGATTTGTTTGCAATTTGGATATGCCGGTATGAATATCATAACT...

CDS

Download CDS FASTA

1227 bp · TkA01G624280|TK1151|CDS

ATGGAAGGAAAATTAGGATGTTTTGCGAGGTTTTTTCTCACGGCCAAACCATATATTGCCATGATTTGTTTGCAATTTGGATATGCCGGTATGAATATCATAACTAAAGTGTCCCTGAATCGAGGCATGAGCCACTATGTCCTTGTTGTTTATCGGCATGCATTCGCCACTGTTGCTATCGCCCCATTCGCCATCATCTTCGAGAGGAATCTGAGGCCGAAGATTACATTCTCAATTTTTGTGCAAATGTTTGTCTTGGG...

Protein

Download Protein FASTA

408 aa · TkA01G624280|TK1151|PROTEIN

MEGKLGCFARFFLTAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATVAIAPFAIIFERNLRPKITFSIFVQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKLDMKKVRCQAKVIGTIVTVAGAMLMTLYKGNVVELIWTKHVHPHYAETTSASSDSSDKHWVTGSILLIIATFAWASFFILQNVTMRKYTAPLSLTCLVCFIGTLQSIAVTFVMEHKPNAWSIGWDMNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G624280`
TK1151 ID	TkA01G624280
OH-1004 ID	LXL04_009934
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 81.863 / OH-1004 88.329 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G624280

Location Chr01:157602669-157604869 (+)

Description Similar to At1g21890: WAT1-related protein At1g21890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07050`	WAT1-related protein At5g07050.	No verified direct reference in this release
`At2g40900`	WAT1-related protein At2g40900.	No verified direct reference in this release
`At3g56620`	WAT1-related protein At3g56620.	No verified direct reference in this release
`At1g21890`	WAT1-related protein At1g21890.	No verified direct reference in this release
`At2g37460`	WAT1-related protein At2g37460.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009934 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009620 response to fungus Biological Process

GO:0032973 amino acid export across plasma membrane Biological Process

GO:0043090 amino acid import Biological Process

GO:0048316 seed development Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0098712 L-glutamate import across plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015186 L-glutamine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21890

ath:AT1G44800

ath:AT2G39510

ath:AT4G08290

ath:AT4G08300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.646

Rank 1 · TkA01G624280 · TK1151

Endoplasmic reticulum0.129

Rank 2 · TkA01G624280 · TK1151

Lysosome / Vacuole0.124

Rank 3 · TkA01G624280 · TK1151

Cytoplasm0.065

Rank 4 · TkA01G624280 · TK1151

Golgi apparatus0.054

Rank 5 · TkA01G624280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA18-158 aa

PF15839TEX2950-59 aa

PF28043KwaA76-128 aa

PF15839TEX29138-169 aa

PF28043KwaA185-212 aa

PF00892EamA194-332 aa

PF28043KwaA198-242 aa

PF15839TEX29276-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G624280	`PF00892`	EamA	18	158	8.4e-26	91.6
TkA01G624280	`PF15839`	TEX29	50	59	3.1	9.0
TkA01G624280	`PF28043`	KwaA	76	128	0.14	12.7
TkA01G624280	`PF15839`	TEX29	138	169	3.1	9.0
TkA01G624280	`PF28043`	KwaA	185	212	0.14	12.7
TkA01G624280	`PF00892`	EamA	194	332	8.4e-26	91.6
TkA01G624280	`PF28043`	KwaA	198	242	0.14	12.7
TkA01G624280	`PF15839`	TEX29	276	306	3.1	9.0
TkA01G624280	`PF28043`	KwaA	288	366	0.14	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL41`	Arabidopsis thaliana	sp\|Q9FL41\|WTR38_ARATH WAT1-related protein At5g07050	64.800%	Swiss-Prot	High
`F4IJ08`	Arabidopsis thaliana	sp\|F4IJ08\|WTR15_ARATH WAT1-related protein At2g40900	53.400%	Swiss-Prot	High
`Q9LXX8`	Arabidopsis thaliana	sp\|Q9LXX8\|WTR27_ARATH WAT1-related protein At3g56620	53.800%	Swiss-Prot	High
`F4HZQ7`	Arabidopsis thaliana	sp\|F4HZQ7\|WTR5_ARATH WAT1-related protein At1g21890	48.300%	Swiss-Prot	Medium
`Q9ZUS1`	Arabidopsis thaliana	sp\|Q9ZUS1\|WTR13_ARATH WAT1-related protein At2g37460	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card