TkA01G617700 | RubberDandelionOmics

Gene overview

TkA01G617700

Reference: TK1151 Chr: Chr01 Coordinates: 155891189-155899954 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2051 bp · TkA01G617700|TK1151|cDNA

TAAGAAATAACTTGACATGCTAATAATAAGGTCAAATATGATATACATATTTTGTCCAACTTTTTTTTTTTATAAAGTAAGCCAAAAAACAATACCAATGTCTCAGGGTAATAAGTAATAACACATATATATACAGTATAAACCACAATCAAGTTCGCAAAGCTTTAAGCCCCAAGAACAAAGTTGATAACTTAATAATTAAGATGGAAAAGGAAGAAGTGGTGGTGTTAGTGGTGCCCTTTGTGCTTCAAGGTCATCTC...

CDS

Download CDS FASTA

1275 bp · TkA01G617700|TK1151|CDS

ATGAGCTCAGTCGTTCAAGATGTAGTTTCATATGAAAACGCAGAATCTTATGTCTTCCATGGTGCTTCGGCTTTCACCACGTTTTCGTACATTTGGGAAGCGAATGGAAGGCCATCTTTAGATGATACTGAATCGTATATGCAACTTACAAAGGTCCCTGCTCTTGAAGGTATTATACCCCCAGAAATTCTGGAATCCGTTATGTGTCATAGTATCTGCAGTACCTTTAATTCAGGCAATCTTCATGACACATGTAAAGT...

Protein

Download Protein FASTA

424 aa · TkA01G617700|TK1151|PROTEIN

MSSVVQDVVSYENAESYVFHGASAFTTFSYIWEANGRPSLDDTESYMQLTKVPALEGIIPPEILESVMCHSICSTFNSGNLHDTCKVFDGKFIDFLSKQGLAGSTNQWAMGPFNPVAIIDNKNLNKRHKSLEWLDKQPQNSVIYVSFGTTTSFSDDEIRELANGLENSQHKFIWVLRDADKGDIFNGEIRRVELPEGFEERIEETGLVVREWAPQLEILAHPATGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G617700`
TK1151 ID	TkA01G617700
OH-1004 ID	LXL04_000351
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.300
Protein coverage (%)	TK1151 75.472 / OH-1004 71.681 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G617700`
Location	Chr01:155891189-155899954 (+)
Description	Similar to ZOG1: Zeatin O-glucosyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000351` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009101 glycoprotein biosynthetic process Biological Process GO:0009690 cytokinin metabolic process Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010015 root morphogenesis Biological Process GO:0010083 regulation of vegetative meristem growth Biological Process GO:0010380 regulation of chlorophyll biosynthetic process Biological Process GO:0010817 regulation of hormone levels Biological Process GO:0045926 negative regulation of growth Biological Process GO:0048316 seed development Biological Process GO:0048439 flower morphogenesis Biological Process GO:0080036 regulation of cytokinin-activated signaling pathway Biological Process GO:0035251 UDP-glucosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AAD04166 zma:541881 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · TkA01G617700 · TK1151

Nucleus0.182

Rank 2 · TkA01G617700 · TK1151

Peroxisome0.122

Rank 3 · TkA01G617700 · TK1151

Plastid0.085

Rank 4 · TkA01G617700 · TK1151

Mitochondrion0.063

Rank 5 · TkA01G617700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N1-115 aa

PF00201UDPGT133-262 aa

PF07249Cerato-platanin205-236 aa

PF06722EryCIII-like_C208-280 aa

PF04101Glyco_tran_28_C229-287 aa

PF21816Zap1_zf1230-239 aa

PF07249Cerato-platanin305-326 aa

PF00201UDPGT311-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G617700	`PF26168`	Glyco_transf_N	1	115	3.9e-13	50.6
TkA01G617700	`PF00201`	UDPGT	133	262	1.4e-31	110.6
TkA01G617700	`PF07249`	Cerato-platanin	205	236	0.1	13.5
TkA01G617700	`PF06722`	EryCIII-like_C	208	280	5.5e-05	23.9
TkA01G617700	`PF04101`	Glyco_tran_28_C	229	287	0.0028	18.4
TkA01G617700	`PF21816`	Zap1_zf1	230	239	0.28	11.6
TkA01G617700	`PF07249`	Cerato-platanin	305	326	0.1	13.5
TkA01G617700	`PF00201`	UDPGT	311	354	1.4e-31	110.6
TkA01G617700	`PF06722`	EryCIII-like_C	314	400	5.5e-05	23.9
TkA01G617700	`PF04101`	Glyco_tran_28_C	319	366	0.0028	18.4
TkA01G617700	`PF21816`	Zap1_zf1	320	329	0.28	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card