TkA01G608550 | RubberDandelionOmics

Gene overview

TkA01G608550

Reference: TK1151 Chr: Chr01 Coordinates: 153393391-153394056 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · TkA01G608550|TK1151|cDNA

ATCCCCTAAAATCGCTCGTCCTTCATTTCCATCGTGTTCAACAAGTTTCAGATTTTGAAGCAATTACAAAATGTCTGGACGTGGAAAGGGAGGAAAGGGATTGGGAAAGGGAGGGGCGAAACGCCACAGAAAAGTTCTCCGTGACAATATCCAGGGTATCACGAAACCGGCGATACGTCGTCTGGCGAGGAGAGGCGGTGTGAAGCGTATTAGCGGTTTAATTTACGAAGAGACTCGTGGAGTTCTTAAGATATTTTTGG...

CDS

Download CDS FASTA

312 bp · TkA01G608550|TK1151|CDS

ATGTCTGGACGTGGAAAGGGAGGAAAGGGATTGGGAAAGGGAGGGGCGAAACGCCACAGAAAAGTTCTCCGTGACAATATCCAGGGTATCACGAAACCGGCGATACGTCGTCTGGCGAGGAGAGGCGGTGTGAAGCGTATTAGCGGTTTAATTTACGAAGAGACTCGTGGAGTTCTTAAGATATTTTTGGAAAATGTGATCAGAGACGCTGTTACTTACACAGAGCACGCTCGTCGGAAAACTGTTACCGCCATGGATGT...

Protein

Download Protein FASTA

103 aa · TkA01G608550|TK1151|PROTEIN

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G608550`
TK1151 ID	TkA01G608550
OH-1004 ID	LXL04_000530
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G608550

Location Chr01:153393391-153394056 (+)

Description Similar to Histone H4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P59259`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

gmx:100305586

gmx:100777359

gmx:100778317

gmx:100779597

gmx:100784085

gmx:100784197

gmx:100788767

gmx:100793106

gmx:100799680

gmx:100800769

gmx:100805597

gmx:100818211

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA01G608550 · TK1151

Cytoplasm0.084

Rank 2 · TkA01G608550 · TK1151

Extracellular0.016

Rank 3 · TkA01G608550 · TK1151

Mitochondrion0.008

Rank 4 · TkA01G608550 · TK1151

Cell membrane0.008

Rank 5 · TkA01G608550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03677UPF013722-94 aa

PF02969TAF34-92 aa

PF15511CENP-T_C44-96 aa

PF07524Bromo_TP57-93 aa

PF00125Histone58-92 aa

PF00808CBFD_NFYB_HMF58-91 aa

PF02291TFIID-31kDa62-94 aa

PF15630CENP-S63-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G608550	`PF03677`	UPF0137	22	94	0.34	11.4
TkA01G608550	`PF02969`	TAF	34	92	0.00014	22.7
TkA01G608550	`PF15511`	CENP-T_C	44	96	2.5e-08	34.7
TkA01G608550	`PF07524`	Bromo_TP	57	93	0.016	15.9
TkA01G608550	`PF00125`	Histone	58	92	0.00045	21.3
TkA01G608550	`PF00808`	CBFD_NFYB_HMF	58	91	0.0017	19.3
TkA01G608550	`PF02291`	TFIID-31kDa	62	94	0.006	17.4
TkA01G608550	`PF15630`	CENP-S	63	94	0.00071	20.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59259`	Arabidopsis thaliana	sp\|P59259\|H4_ARATH Histone H4	100.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card