Gene Card
Gene overview
cDNA / CDS / Protein Sequences
312 bp · LXL04_000530|LXL04_000530|OH1004|cDNA
ATGTCAGGCCGTGGTAAGGGAGGCAAAGGATTGGGAAAGGGAGGAGCAAAGCGTCATCGCAAGGTTCTTCGCGATAACATTCAGGGAATCACTAAACCCGCCATCAGAAGGTTGGCTCGTAGAGGAGGTGTGAAGCGTATCAGTGGTTTGATCTATGAGGAAACTCGTGGAGTTCTCAAGATCTTTCTAGAGAACGTCATCAGAGACGCCGTCACCTACACAGAGCACGCCCGCAGGAAGACTGTCACCGCCATGGATGT...
312 bp · LXL04_000530|LXL04_000530|OH1004|CDS
ATGTCAGGCCGTGGTAAGGGAGGCAAAGGATTGGGAAAGGGAGGAGCAAAGCGTCATCGCAAGGTTCTTCGCGATAACATTCAGGGAATCACTAAACCCGCCATCAGAAGGTTGGCTCGTAGAGGAGGTGTGAAGCGTATCAGTGGTTTGATCTATGAGGAAACTCGTGGAGTTCTCAAGATCTTTCTAGAGAACGTCATCAGAGACGCCGTCACCTACACAGAGCACGCCCGCAGGAAGACTGTCACCGCCATGGATGT...
Protein
Download Protein FASTA103 aa · LXL04_000530|LXL04_000530|OH1004|PROTEIN
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000530 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000530 |
|---|---|
| Location | Chr01:9907848-9908159 (-) |
| Description | Similar to Histone H4 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006334 nucleosome assembly Biological Process GO:0000786 nucleosome Cellular Component GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0030527 structural constituent of chromatin Molecular Function GO:0046982 protein heterodimerization activity Molecular Function |
| KEGG gene cross-reference | gmx:100305586 gmx:100777359 gmx:100778317 gmx:100779597 gmx:100784085 gmx:100784197 gmx:100788767 gmx:100793106 gmx:100799680 gmx:100800769 gmx:100805597 gmx:100818211 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF15511.13CENP-T_C44-96 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000530 | PF15511.13 | CENP-T_C | 44 | 96 | 2.5e-08 | 34.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.