TkA01G600500 | RubberDandelionOmics

Gene overview

TkA01G600500

Reference: TK1151 Chr: Chr01 Coordinates: 151269601-151271812 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1167 bp · TkA01G600500|TK1151|cDNA

ATGAAGTGTTTTCACTTTAGTATTGGAGATAGGAGAGCCAACGACGAGGATGTTGTCCTTTCGAGGTCATCGACCAGGTTATCGTGGGCGCGTTCTCTCAGCGTAGCATCCACCAGCTTCGACACAACTCGTCGCTCGGAGTTTGATTCCGACAGCAACTCTCGGGACCTCAGCGGTACCGTCGGGTTCTCTGAGCTCTTATCTCAGCGCCGTGCGAACGATCTGCGAGTTTTTAAGTTCGCTGAGTTGAAGTCTGCGAC...

CDS

Download CDS FASTA

1167 bp · TkA01G600500|TK1151|CDS

ATGAAGTGTTTTCACTTTAGTATTGGAGATAGGAGAGCCAACGACGAGGATGTTGTCCTTTCGAGGTCATCGACCAGGTTATCGTGGGCGCGTTCTCTCAGCGTAGCATCCACCAGCTTCGACACAACTCGTCGCTCGGAGTTTGATTCCGACAGCAACTCTCGGGACCTCAGCGGTACCGTCGGGTTCTCTGAGCTCTTATCTCAGCGCCGTGCGAACGATCTGCGAGTTTTTAAGTTCGCTGAGTTGAAGTCTGCGAC...

Protein

Download Protein FASTA

388 aa · TkA01G600500|TK1151|PROTEIN

MKCFHFSIGDRRANDEDVVLSRSSTRLSWARSLSVASTSFDTTRRSEFDSDSNSRDLSGTVGFSELLSQRRANDLRVFKFAELKSATKGFNRSLVIGEGGFGCVYRGSDEDRDLDVAIKQLSRNGFQGHKEWINEVNFLGIVNHPNLVKLVGYCAEDDERGIQRLLVYELMQNKSLEDHLLGRVHSPLSWMTRLQIALGAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNPKLSDFGLARQGPAAGISHVSTVVVGTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G600500`
TK1151 ID	TkA01G600500
OH-1004 ID	LXL04_000596
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 96.392 / OH-1004 83.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G600500

Location Chr01:151269601-151271812 (+)

Description Similar to PCRK1: Serine/threonine-protein kinase PCRK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09830`	Involved in the activation of early immune responses.	The receptor-like cytoplasmic kinase PCRK1 contributes to pattern-triggered immunity against Pseudomonas syringae in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13345 Functional characterization of PCRK1, a putative protein kinase with a role in immunity.2015 · DOI: 10.1080/15592324.2015.1063759
`At5g03320`	Functions redundantly with PCRK1 in basal resistance against bacterial pathogens and in regulation of plant immunity.	No verified direct reference in this release
`At5g47070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g15080`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g28690`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT3G09830

ath:AT3G28690

ath:AT5G03320

ath:AT5G15080

ath:AT5G47070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.600

Rank 1 · TkA01G600500 · TK1151

Cytoplasm0.274

Rank 2 · TkA01G600500 · TK1151

Nucleus0.249

Rank 3 · TkA01G600500 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA01G600500 · TK1151

Golgi apparatus0.031

Rank 5 · TkA01G600500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase94-364 aa

PF07714PK_Tyr_Ser-Thr95-366 aa

PF01636APH145-178 aa

PF14531Kinase-like184-289 aa

PF01636APH204-246 aa

PF06299DUF1045293-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G600500	`PF00069`	Pkinase	94	364	1.9e-47	162.6
TkA01G600500	`PF07714`	PK_Tyr_Ser-Thr	95	366	6.3e-45	154.2
TkA01G600500	`PF01636`	APH	145	178	0.041	14.3
TkA01G600500	`PF14531`	Kinase-like	184	289	0.00014	22.0
TkA01G600500	`PF01636`	APH	204	246	0.041	14.3
TkA01G600500	`PF06299`	DUF1045	293	350	0.045	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF86`	Arabidopsis thaliana	sp\|Q9SF86\|PCRK1_ARATH Serine/threonine-protein kinase PCRK1	59.300%	Swiss-Prot	High
`Q9LZF8`	Arabidopsis thaliana	sp\|Q9LZF8\|PCRK2_ARATH Serine/threonine-protein kinase PCRK2	57.900%	Swiss-Prot	High
`Q9LTC0`	Arabidopsis thaliana	sp\|Q9LTC0\|PBL19_ARATH Probable serine/threonine-protein kinase PBL19	57.700%	Swiss-Prot	High
`Q9LFP7`	Arabidopsis thaliana	sp\|Q9LFP7\|PBL34_ARATH Serine/threonine-protein kinase PBL34	55.300%	Swiss-Prot	High
`F4J0D2`	Arabidopsis thaliana	sp\|F4J0D2\|PBL36_ARATH Serine/threonine-protein kinase PBL36	57.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card