LXL04_000596 | RubberDandelionOmics

Gene overview

LXL04_000596

Reference: OH-1004 Chr: Chr01 Coordinates: 10841699-10844111 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · LXL04_000596|LXL04_000596|OH1004|cDNA

ATGAAGTGTTTTCACTTTAGTATTGGAGATAGGAGAGCCAACGACGAGGATGTTGTCCTTTCGAGGTCATCGACCAGGTTATCGTGGGCGCGTTCTCTCAGCGTAGCATCCACCAGCTTCGACACAACTCGTCGCTCGGAGTTTGATTCCGACAGCAACTCTCGGGACCTCAGCGGTACCGTCGGGTTCTCTGAGCTCTTATCTCAGCGCCGTGCGAACGATCTGCGAGTTTTTAAGTTCGCTGAGTTGAAGTCTGCGAC...

CDS

Download CDS FASTA

1386 bp · LXL04_000596|LXL04_000596|OH1004|CDS

ATGAAGTGTTTTCACTTTAGTATTGGAGATAGGAGAGCCAACGACGAGGATGTTGTCCTTTCGAGGTCATCGACCAGGTTATCGTGGGCGCGTTCTCTCAGCGTAGCATCCACCAGCTTCGACACAACTCGTCGCTCGGAGTTTGATTCCGACAGCAACTCTCGGGACCTCAGCGGTACCGTCGGGTTCTCTGAGCTCTTATCTCAGCGCCGTGCGAACGATCTGCGAGTTTTTAAGTTCGCTGAGTTGAAGTCTGCGAC...

Protein

Download Protein FASTA

461 aa · LXL04_000596|LXL04_000596|OH1004|PROTEIN

MKCFHFSIGDRRANDEDVVLSRSSTRLSWARSLSVASTSFDTTRRSEFDSDSNSRDLSGTVGFSELLSQRRANDLRVFKFAELKSATKGFNRSLVIGEGGFGCVYRGVVKAAAGADAGSDEDRDLDVAIKQLSRNGFQGHKEWINEVNFLGIVNHPNLVKLVGYCAEDDERGIQRLLVYELMQNKSLEDHLLGRVHSPLSWMTRLQIALGAARGLAYLHEEMDFQLIFRDFKTSNVLLDEDFNPKLSDFGLARQGPAAGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000596`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000596

Location Chr01:10841699-10844111 (-)

Description Similar to PCRK1: Serine/threonine-protein kinase PCRK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09830`	Involved in the activation of early immune responses.	The receptor-like cytoplasmic kinase PCRK1 contributes to pattern-triggered immunity against Pseudomonas syringae in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13345 Functional characterization of PCRK1, a putative protein kinase with a role in immunity.2015 · DOI: 10.1080/15592324.2015.1063759
`At5g03320`	Functions redundantly with PCRK1 in basal resistance against bacterial pathogens and in regulation of plant immunity.	No verified direct reference in this release
`At5g47070`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g15080`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g28690`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000596 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT3G09830

ath:AT3G28690

ath:AT5G03320

ath:AT5G15080

ath:AT5G47070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.657

Rank 1 · LXL04_000596 · OH-1004

Cytoplasm0.230

Rank 2 · LXL04_000596 · OH-1004

Nucleus0.225

Rank 3 · LXL04_000596 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_000596 · OH-1004

Golgi apparatus0.032

Rank 5 · LXL04_000596 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase94-375 aa

PF07714.24PK_Tyr_Ser-Thr95-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000596	`PF00069.32`	Pkinase	94	375	4.6e-43	148.2
LXL04_000596	`PF07714.24`	PK_Tyr_Ser-Thr	95	377	1.2e-45	156.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF86`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK1	57.711%	Swiss-Prot	strong database homology
`Q9LZF8`	Arabidopsis thaliana	Serine/threonine-protein kinase PCRK2	57.398%	Swiss-Prot	strong database homology
`Q9LTC0`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL19	55.398%	Swiss-Prot	strong database homology
`Q9LFP7`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL34	50.000%	Swiss-Prot	strong database homology
`F4J0D2`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL36	53.687%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card