TkA01G599510 | RubberDandelionOmics

Gene overview

TkA01G599510

Reference: TK1151 Chr: Chr01 Coordinates: 150986053-150987729 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · TkA01G599510|TK1151|cDNA

TTTTTTTCTTTATAGGCACACCATCAAATAAAGAGCTAAGCGGATAGGTCCGTAAAACGCTCCTGGAGAGGATAACATAACACACACTCATCCAGAGCTTTCTCACACACAACAATGGCGAGCTGTGTAAGAATTCCATCTTCAATCTCATTCCTTTCGTCCTCCATTTTCTCCCTTTCTTCGTCTAATCAAACCCCCTCCACCTCTCTATTTATCAAACCCCCAAAATCCCACGTTCTCAAATGCAACACCGCCGTAAT...

CDS

Download CDS FASTA

873 bp · TkA01G599510|TK1151|CDS

ATGGCGAGCTGTGTAAGAATTCCATCTTCAATCTCATTCCTTTCGTCCTCCATTTTCTCCCTTTCTTCGTCTAATCAAACCCCCTCCACCTCTCTATTTATCAAACCCCCAAAATCCCACGTTCTCAAATGCAACACCGCCGTAATCCGCTCCGAACTCGCCACACTCCCAGTACTCTCCTTCGATGGCACCAAGGTCGGAGAAACTACTCTCAACCTCAAATCCGCCCACCCAGACACTGCCCGCGCCGTTGTCCACCG...

Protein

Download Protein FASTA

290 aa · TkA01G599510|TK1151|PROTEIN

MASCVRIPSSISFLSSSIFSLSSSNQTPSTSLFIKPPKSHVLKCNTAVIRSELATLPVLSFDGTKVGETTLNLKSAHPDTARAVVHRGITTDLNNKRRGTASTLTRAEVRGGGKKPFPQKKLGRARRGSQRTPLRPGGGVVFGPKPRDWTVKINKKEKRLAISTALASAAVNGIVVEEFGDKFEKPKTKDFLEALKRWGIDPKEKSMFFMTEISDNVVLSSRNIGTLKMLTPRTLNLFDILNADKLVFTKAALDYLNEAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G599510`
TK1151 ID	TkA01G599510
OH-1004 ID	LXL04_000613
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G599510

Location Chr01:150986053-150987729 (-)

Description Similar to RPL4: 50S ribosomal protein L4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07320`	This protein binds directly and specifically to 23S rRNA (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000613 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006412 translation Biological Process

GO:0000311 plastid large ribosomal subunit Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009547 plastid ribosome Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G07320

mar:MAE_57420

nta:107817573

tel:tlr0082

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · TkA01G599510 · TK1151

Mitochondrion0.032

Rank 2 · TkA01G599510 · TK1151

Cytoplasm0.011

Rank 3 · TkA01G599510 · TK1151

Nucleus0.010

Rank 4 · TkA01G599510 · TK1151

Cell membrane0.006

Rank 5 · TkA01G599510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13663DUF414810-27 aa

PF00573Ribosomal_L479-258 aa

PF13663DUF414898-110 aa

PF13663DUF4148161-188 aa

PF00702Hydrolase168-204 aa

PF00702Hydrolase258-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G599510	`PF13663`	DUF4148	10	27	0.33	12.0
TkA01G599510	`PF00573`	Ribosomal_L4	79	258	2.9e-56	190.9
TkA01G599510	`PF13663`	DUF4148	98	110	0.33	12.0
TkA01G599510	`PF13663`	DUF4148	161	188	0.33	12.0
TkA01G599510	`PF00702`	Hydrolase	168	204	0.25	12.4
TkA01G599510	`PF00702`	Hydrolase	258	273	0.25	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O50061`	Arabidopsis thaliana	sp\|O50061\|RK4_ARATH Large ribosomal subunit protein uL4c	67.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card