RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G598720
Reference: TK1151 Chr: Chr01 Coordinates: 150789029-150789740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

591 bp · TkA01G598720|TK1151|cDNA

CTCTCTCTCTCTCTCTCTCTCTCAGTTCTCGCCGGCTACAGAAATATCACCGCCATACTCCTTACCAAATTCAAGAGCTCGAATCGTTTTGATGCATTAGTTGTTTTTGTCGACAGTTCTCCACACCCAGATGAGAAAGAAAGATTAGCGCTTGGAAAACAAACAAGTCAAATTCTGGTTTCAAAATCGACGTACTCAAATGAAGAAACAACATCGTTGCAGACTCAATTGGAGCGCTATGAAAACGCGATTCTGAAACA...

CDS

Download CDS FASTA

591 bp · TkA01G598720|TK1151|CDS

CTCTCTCTCTCTCTCTCTCTCTCAGTTCTCGCCGGCTACAGAAATATCACCGCCATACTCCTTACCAAATTCAAGAGCTCGAATCGTTTTGATGCATTAGTTGTTTTTGTCGACAGTTCTCCACACCCAGATGAGAAAGAAAGATTAGCGCTTGGAAAACAAACAAGTCAAATTCTGGTTTCAAAATCGACGTACTCAAATGAAGAAACAACATCGTTGCAGACTCAATTGGAGCGCTATGAAAACGCGATTCTGAAACA...

Protein

Download Protein FASTA

196 aa · TkA01G598720|TK1151|PROTEIN

LSLSLSLSVLAGYRNITAILLTKFKSSNRFDALVVFVDSSPHPDEKERLALGKQTSQILVSKSTYSNEETTSLQTQLERYENAILKQENDKLRIENIAMKEAIRALVCNNCGGQAILGDISIDEHHLRIENARLRDELSRISILNRRTPSQCFPTPSFCIDLISPYSQDNQSSRPKHKSGNQIFGRFNCQREVEDC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G598720
TK1151 IDTkA01G598720
OH-1004 IDLXL04_021674
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)78.100
Protein coverage (%)TK1151 53.571 / OH-1004 12.931
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G598720
LocationChr01:150789029-150789740 (+)
DescriptionSimilar to ANL2: Homeobox-leucine zipper protein ANTHOCYANINLESS 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g52170 Probable transcription factor that binds to the DNA sequence 5'-GCATTAAATGC-3'. No verified direct reference in this release
At3g61150 Probable transcription factor (By similarity).
CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
At4g21750 Probable transcription factor involved in cell specification and pattern formation during embryogenesis.
Identification of a cis-regulatory element for L1 layer-specific gene expression, which is targeted by an L1-specific homeodomain protein.2001 · DOI: 10.1046/j.1365-313x.2001.01047.x
Regulation of shoot epidermal cell differentiation by a pair of homeodomain proteins in Arabidopsis.2003 · DOI: 10.1242/dev.00292
Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.2014 · DOI: 10.1105/tpc.114.127647

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0674800 Probable transcription factor. No verified direct reference in this release
Os04g0569100 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021674 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009827 plant-type cell wall modification Biological Process
GO:0010143 cutin biosynthetic process Biological Process
GO:0030154 cell differentiation Biological Process
GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process
GO:0048364 root development Biological Process
GO:0048497 maintenance of floral organ identity Biological Process
GO:0048765 root hair cell differentiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT3G61150
ath:AT4G00730
dosa:Os02g0674800
dosa:Os04g0569100
dosa:Os09g0526300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.462
Rank 1 · TkA01G598720 · TK1151
Nucleus0.462
Rank 2 · TkA01G598720 · TK1151
Cell membrane0.086
Rank 3 · TkA01G598720 · TK1151
Mitochondrion0.070
Rank 4 · TkA01G598720 · TK1151
Endoplasmic reticulum0.050
Rank 5 · TkA01G598720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29645CHCH3_N66-92 aa
PF02183HALZ68-79 aa
PF06156YabA70-103 aa
PF28489TUSC176-99 aa
PF21924XRCC4_CC78-107 aa
PF23204KIF21A_2nd80-110 aa
PF02183HALZ83-101 aa
PF21924XRCC4_CC101-141 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G598720PF29645CHCH3_N66920.000920.1
TkA01G598720PF02183HALZ68790.511.3
TkA01G598720PF06156YabA701030.07714.3
TkA01G598720PF28489TUSC176990.2611.9
TkA01G598720PF21924XRCC4_CC781070.113.5
TkA01G598720PF23204KIF21A_2nd801100.02415.6
TkA01G598720PF02183HALZ831010.511.3
TkA01G598720PF21924XRCC4_CC1011410.113.5
TkA01G598720PF06156YabA1181420.07714.3
TkA01G598720PF23204KIF21A_2nd1261350.02415.6
TkA01G598720PF02183HALZ1271400.511.3
TkA01G598720PF29645CHCH3_N1281490.000920.1
TkA01G598720PF28489TUSC11291470.2611.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LTK3Arabidopsis thalianasp|Q9LTK3|HDG7_ARATH Homeobox-leucine zipper protein HDG745.900%Swiss-ProtMedium
Q9M2E8Arabidopsis thalianasp|Q9M2E8|HDG1_ARATH Homeobox-leucine zipper protein HDG148.500%Swiss-ProtMedium
Q8RWU4Arabidopsis thalianasp|Q8RWU4|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L144.500%Swiss-ProtMedium
Q6EPF0Oryza sativa subsp. japonicasp|Q6EPF0|ROC5_ORYSJ Homeobox-leucine zipper protein ROC551.900%Swiss-ProtMedium
Q7Y0V9Oryza sativa subsp. japonicasp|Q7Y0V9|ROC4_ORYSJ Homeobox-leucine zipper protein ROC451.900%Swiss-ProtMedium

JBrowse

View in Genome Browser