TkA01G590080 | RubberDandelionOmics

Gene overview

TkA01G590080

Reference: TK1151 Chr: Chr01 Coordinates: 148453367-148457908 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3615 bp · TkA01G590080|TK1151|cDNA

CAGCAATCCTCTGAAATCGGATCTTTGAATTTTTTGGATCTGGATCAGTTACGTCGGGTTTGGACCGATCACATAATAATTAATGATTTGATTTTGTCATTTAATTGATCGCCTGTCTGAAAATGTCTTAAGACCATAATAGGTCAACACGCAGATTGACCAACATATCATGAATTTCTCGCGAGAAAATAAGTTCGAATTTAAAAAACGTGATGGAGAAAGTGCCAAGATCGACACAGACGGAGGAACGACGAAGTGAA...

CDS

Download CDS FASTA

2235 bp · TkA01G590080|TK1151|CDS

ATGGATGATTTCGGTATGTTAGCGAAAGATTTTGGGTTTCGGCCTCAAGGAAAATCTGCTCCGATGAAATCGAGTGGTGGAGATCGCCGGAGTCGACATTCACCGTCGTCAGCAACATTGTCTGCGGATGGAAATGGTATATTTAACGACGTCTTTGGCGGTCCGCCTAAATACACCAACAACAACGCTAACTCCAAATCCACATCGTCAATGTCTGATTTCGATTACGATTCGATTTTCAAGGACTCTGTATCGGCCAA...

Protein

Download Protein FASTA

744 aa · TkA01G590080|TK1151|PROTEIN

MDDFGMLAKDFGFRPQGKSAPMKSSGGDRRSRHSPSSATLSADGNGIFNDVFGGPPKYTNNNANSKSTSSMSDFDYDSIFKDSVSANNNEAKTKPTSSNSPVYDKPVYDDDVFDGLPGIKSKPISSSSSGRYDDNIFASMTSSPPKPSPLTDHFDDLFSNLGRTEKAQPSKHQYDQSPRGFDELISGFGSGSPASGTRWNSDPSPKSANKTKEKSNPLDDPFSVLESISTPVTSSRTLFTDPLEEITKIGKSNTRKPSSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G590080`
TK1151 ID	TkA01G590080
OH-1004 ID	LXL04_000754
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G590080

Location Chr01:148453367-148457908 (+)

Description Similar to At4g12770: Auxilin-related protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12770`	Promotes probably uncoating of clathrin-coated vesicles.	No verified direct reference in this release
`At4g12780`	Promotes uncoating of clathrin-coated vesicles.	No verified direct reference in this release
`At1g75310`	Auxilin-like protein 1.	No verified direct reference in this release
`At1g75100`	Required for chloroplast photorelocation movement; chloroplast accumulation upon low blue light and for chloroplast movement to the bottom of cells in darkness, by modulating chloroplast actin (Cp-actin) filaments distribution, appearance and disappearance.	An auxilin-like J-domain protein, JAC1, regulates phototropin-mediated chloroplast movement in Arabidopsis.2005 · DOI: 10.1104/pp.105.067371 Overexpression of an auxilin-like gene (F9E10.5) can suppress Al uptake in roots of Arabidopsis.2007 · DOI: 10.1093/jxb/erl221 Crystallographic and functional analyses of J-domain of JAC1 essential for chloroplast photorelocation movement in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq089 Red light, Phot1 and JAC1 modulate Phot2-dependent reorganization of chloroplast actin filaments and chloroplast avoidance movement.2011 · DOI: 10.1093/pcp/pcr087

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000754 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045806 negative regulation of endocytosis Biological Process

GO:0045926 negative regulation of growth Biological Process

GO:0072318 clathrin coat disassembly Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:1900186 negative regulation of clathrin-dependent endocytosis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

KEGG gene cross-reference

ath:AT1G75310

ath:AT4G12770

ath:AT4G12780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.648

Rank 1 · TkA01G590080 · TK1151

Cell membrane0.210

Rank 2 · TkA01G590080 · TK1151

Nucleus0.161

Rank 3 · TkA01G590080 · TK1151

Golgi apparatus0.092

Rank 4 · TkA01G590080 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA01G590080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ690-737 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G590080	`PF00226`	DnaJ	690	737	0.00019	22.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQ57`	Arabidopsis thaliana	sp\|Q0WQ57\|AUXI2_ARATH Auxilin-related protein 2	69.300%	Swiss-Prot	Low
`Q9SU08`	Arabidopsis thaliana	sp\|Q9SU08\|AUXI1_ARATH Auxilin-related protein 1	67.600%	Swiss-Prot	Low
`Q9FWS1`	Arabidopsis thaliana	sp\|Q9FWS1\|AUL1_ARATH Auxilin-like protein 1	61.600%	Swiss-Prot	Low
`Q9C9Q4`	Arabidopsis thaliana	sp\|Q9C9Q4\|JAC1_ARATH J domain-containing protein required for chloroplast accumulation response 1	56.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card