TkA01G589550 | RubberDandelionOmics

Gene overview

TkA01G589550

Reference: TK1151 Chr: Chr01 Coordinates: 148320337-148323989 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3323 bp · TkA01G589550|TK1151|cDNA

GCCATAGCCAATTACCTAAATCTTAGCTGTAAACACACAATCCCCACCTCATGTCTGCAACATTTTCACCTTCCAGAAATTACTGCAAAATCATTCACACTCACCCACTGCTTAAACACATTCATGGAGATTCTCTCTCTTGCTCCCTCTTTCTTTCCCATATGATATCAACTCTCACTCGAATCTGAATTTCAAGAAATAAACAAGCCCCACCCAGTAATCACATCTGCATTTACTCTCTTAATCTATCCATGAAAATG...

CDS

Download CDS FASTA

2814 bp · TkA01G589550|TK1151|CDS

ATGAAAATGCCCATCTTCTCATTCGTTCTCCCCTTCATTTTCATCTTAACTTGTACAAAATCTGCCATCGGAGCCACCGACACCGCCGTCCACAACCGCCGGACGCTGCACCAACCGTTCTTCCCACAAGATTCTCCCGGTGTACCTCCGTTGTCATCATCATCTGAGGTACCGTTTACTCCTAACCCCACTACCACAACCCCATCGCCGGGCGATGGCCAGCCGTTTTTCCCATCTGTTCCCACTACCCCGCCTCCGCC...

Protein

Download Protein FASTA

937 aa · TkA01G589550|TK1151|PROTEIN

MKMPIFSFVLPFIFILTCTKSAIGATDTAVHNRRTLHQPFFPQDSPGVPPLSSSSEVPFTPNPTTTTPSPGDGQPFFPSVPTTPPPPSVSTPSASFPANISSLNLPSSPKSKPVSSKLIATAVTLVIAAAIVTAIVVYLRIKKRRGHAHDSRSFSDEKTHRSDSSSRVVVSCNVNNGSGGGGSNNNFNRIPKLSRPSQSSAEFLYLGTLVNAHGGIDANNASARDSRGVGDSNLRKLDSPELRPLPPLGSVGGNGVRTQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G589550`
TK1151 ID	TkA01G589550
OH-1004 ID	LXL04_036690
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.700
Protein coverage (%)	TK1151 98.399 / OH-1004 98.462 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G589550

Location Chr01:148320337-148323989 (-)

Description Similar to FH1: Formin-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25500`	Might be involved in the organization and polarity of the actin cytoskeleton.	Overexpression of an Arabidopsis formin stimulates supernumerary actin cable formation from pollen tube cell membrane.2004 · DOI: 10.1105/tpc.016550 The formin homology 1 domain modulates the actin nucleation and bundling activity of Arabidopsis FORMIN1.2005 · DOI: 10.1105/tpc.105.030908
`At2g43800`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0897700`	Formin-like protein 1.	No verified direct reference in this release
`Os09g0517600`	Formin-like protein 15.	No verified direct reference in this release
`Os03g0204100`	Formin-like protein 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0051016 barbed-end actin filament capping Biological Process

GO:0005634 nucleus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT2G43800

ath:AT3G25500

dosa:Os01g0897700

osa:4325107

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.721

Rank 1 · TkA01G589550 · TK1151

Nucleus0.184

Rank 2 · TkA01G589550 · TK1151

Cytoplasm0.177

Rank 3 · TkA01G589550 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA01G589550 · TK1151

Plastid0.028

Rank 5 · TkA01G589550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25184YxzE5-22 aa

PF27898C3orf18_N121-145 aa

PF25184YxzE122-182 aa

PF25184YxzE317-326 aa

PF02181FH2483-881 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G589550	`PF25184`	YxzE	5	22	0.16	13.7
TkA01G589550	`PF27898`	C3orf18_N	121	145	0.47	11.2
TkA01G589550	`PF25184`	YxzE	122	182	0.16	13.7
TkA01G589550	`PF25184`	YxzE	317	326	0.16	13.7
TkA01G589550	`PF02181`	FH2	483	881	5.2e-119	398.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE97`	Arabidopsis thaliana	sp\|Q9SE97\|FH1_ARATH Formin-like protein 1	73.500%	Swiss-Prot	Low
`O22824`	Arabidopsis thaliana	sp\|O22824\|FH2_ARATH Formin-like protein 2	60.800%	Swiss-Prot	Low
`Q8S0F0`	Oryza sativa subsp. japonica	sp\|Q8S0F0\|FH1_ORYSJ Formin-like protein 1	69.300%	Swiss-Prot	Low
`Q69MT2`	Oryza sativa subsp. japonica	sp\|Q69MT2\|FH15_ORYSJ Formin-like protein 15	58.800%	Swiss-Prot	Low
`Q10Q99`	Oryza sativa subsp. japonica	sp\|Q10Q99\|FH8_ORYSJ Formin-like protein 8	62.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card