LXL04_036690 | RubberDandelionOmics

Gene overview

LXL04_036690

Reference: OH-1004 Chr: Chr08 Coordinates: 46718906-46722029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2733 bp · LXL04_036690|LXL04_036690|OH1004|cDNA

ATGGACCCGCTTGCTAACCCATCCATGGAAATCCATAGCTTTTTCTTCGTTCTTGTGTTAATATCTACCTGCGTCAGCGGCACCACCGTCCGCCGTACGCTACACGAACCTTTCTTCCCGCAGGACGCGCCAATACTCCCTCCGGTTCAACCTCCTTCTGCTCTGCCACCATCTTCACCACCTTCGTTAAATGTGCCGTTTACCAGAACTCCACCCAGTGAGCAACCATTCTTCCAGTCTTTCCCATCACCACCACCTCC...

CDS

Download CDS FASTA

2733 bp · LXL04_036690|LXL04_036690|OH1004|CDS

ATGGACCCGCTTGCTAACCCATCCATGGAAATCCATAGCTTTTTCTTCGTTCTTGTGTTAATATCTACCTGCGTCAGCGGCACCACCGTCCGCCGTACGCTACACGAACCTTTCTTCCCGCAGGACGCGCCAATACTCCCTCCGGTTCAACCTCCTTCTGCTCTGCCACCATCTTCACCACCTTCGTTAAATGTGCCGTTTACCAGAACTCCACCCAGTGAGCAACCATTCTTCCAGTCTTTCCCATCACCACCACCTCC...

Protein

Download Protein FASTA

910 aa · LXL04_036690|LXL04_036690|OH1004|PROTEIN

MDPLANPSMEIHSFFFVLVLISTCVSGTTVRRTLHEPFFPQDAPILPPVQPPSALPPSSPPSLNVPFTRTPPSEQPFFQSFPSPPPPPPSASSSASFPANISSLYLPTSTKPKRVSSKLVPIAIALAIAAVVVLFIVIALRIKKRRSHDDSESFSDEKPQRSYNNSVFSAAADNVGGGNSSYNRIPKLSRPSQTSAEFLYLGTLVNSHGGIDATGTGGRENRGDDDSSLQKMGSPELRPLPPLNGNGGGRSQTILQNRCY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036690`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036690

Location Chr08:46718906-46722029 (+)

Description Similar to FH1: Formin-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25500`	Might be involved in the organization and polarity of the actin cytoskeleton.	Overexpression of an Arabidopsis formin stimulates supernumerary actin cable formation from pollen tube cell membrane.2004 · DOI: 10.1105/tpc.016550 The formin homology 1 domain modulates the actin nucleation and bundling activity of Arabidopsis FORMIN1.2005 · DOI: 10.1105/tpc.105.030908
`At2g43800`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At5g67470`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0897700`	Formin-like protein 1.	No verified direct reference in this release
`Os03g0204100`	Formin-like protein 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036690 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0051016 barbed-end actin filament capping Biological Process

GO:0005634 nucleus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT2G43800

ath:AT3G25500

dosa:Os01g0897700

osa:4325107

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.723

Rank 1 · LXL04_036690 · OH-1004

Nucleus0.177

Rank 2 · LXL04_036690 · OH-1004

Cytoplasm0.173

Rank 3 · LXL04_036690 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_036690 · OH-1004

Plastid0.029

Rank 5 · LXL04_036690 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181.29FH2467-861 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036690	`PF02181.29`	FH2	467	861	6.1e-109	365.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE97`	Arabidopsis thaliana	Formin-like protein 1	65.199%	Swiss-Prot	moderate database homology
`O22824`	Arabidopsis thaliana	Formin-like protein 2	55.936%	Swiss-Prot	weak database homology
`Q9FJX6`	Arabidopsis thaliana	Formin-like protein 6	58.637%	Swiss-Prot	weak database homology
`Q8S0F0`	Oryza sativa subsp. japonica	Formin-like protein 1	63.181%	Swiss-Prot	weak database homology
`Q10Q99`	Oryza sativa subsp. japonica	Formin-like protein 8	57.442%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card