TkA01G580340 | RubberDandelionOmics

Gene overview

TkA01G580340

Reference: TK1151 Chr: Chr01 Coordinates: 146017331-146019995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1156 bp · TkA01G580340|TK1151|cDNA

CCCGTTATTTCCGATGGAAGCAAGCCCCTTTTCCGAACCACAACGTAATTTCTATTCTACCTCAACCCTTTCTCTTTCTGAGTAGTCCCCTTCAACTTTCTCTCTCTTCAAACTCCTCCCCCTCTCCCTCTCTATCTCAAACACACGCACATCATTCATCGGAGGGATGGGGCAGCAGTCGTTGATCTACAGTTTCGTCGCCAGAGGAACGGTGATTCTCTCCGAGTACACGGAGTTCACCGGGAATTTCACTAGCATCG...

CDS

Download CDS FASTA

666 bp · TkA01G580340|TK1151|CDS

ATGGGGCAGCAGTCGTTGATCTACAGTTTCGTCGCCAGAGGAACGGTGATTCTCTCCGAGTACACGGAGTTCACCGGGAATTTCACTAGCATCGCTGCACAGTGTCTCCAGAAGCTTCCTGCTACGAACAACAAGTTTACCTACAACTGCGATGGTCACACCTTCAACTACCTTGTTGCAGATGGATTCACATACTGTGTTGTCGCCGTTGAATCCGTTGGTAGACAGGTTCCAATGGCTTTTCTTGAGCGAGTCAAGGA...

Protein

Download Protein FASTA

221 aa · TkA01G580340|TK1151|PROTEIN

MGQQSLIYSFVARGTVILSEYTEFTGNFTSIAAQCLQKLPATNNKFTYNCDGHTFNYLVADGFTYCVVAVESVGRQVPMAFLERVKDDFTKKYGGGKAATAVANSLNKEFGPKLKEQMQYCVDHPEEINKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQIRRKMWLQNMKIKLIVLGIIIALILIIVLSACGGFNCGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G580340`
TK1151 ID	TkA01G580340
OH-1004 ID	LXL04_000856
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G580340

Location Chr01:146017331-146019995 (-)

Description Similar to VAMP722: Vesicle-associated membrane protein 722

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32670`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At2g33120`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At1g04750`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At1g04760`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At4g15780`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

KEGG gene cross-reference

ath:AT1G04750

ath:AT1G04760

ath:AT2G32670

ath:AT2G33120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.432

Rank 1 · TkA01G580340 · TK1151

Cytoplasm0.380

Rank 2 · TkA01G580340 · TK1151

Golgi apparatus0.204

Rank 3 · TkA01G580340 · TK1151

Lysosome / Vacuole0.164

Rank 4 · TkA01G580340 · TK1151

Endoplasmic reticulum0.146

Rank 5 · TkA01G580340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16992RNA_pol_RpbG8-22 aa

PF13774Longin18-113 aa

PF01661Macro100-174 aa

PF04791LMBR1117-215 aa

PF29008DDB_G0292058_C128-215 aa

PF00957Synaptobrevin130-210 aa

PF16992RNA_pol_RpbG131-203 aa

PF29073RxLR_C177-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G580340	`PF16992`	RNA_pol_RpbG	8	22	0.0043	17.8
TkA01G580340	`PF13774`	Longin	18	113	6.7e-27	94.3
TkA01G580340	`PF01661`	Macro	100	174	0.11	13.2
TkA01G580340	`PF04791`	LMBR1	117	215	0.049	13.2
TkA01G580340	`PF29008`	DDB_G0292058_C	128	215	0.0026	17.4
TkA01G580340	`PF00957`	Synaptobrevin	130	210	1.9e-30	105.3
TkA01G580340	`PF16992`	RNA_pol_RpbG	131	203	0.0043	17.8
TkA01G580340	`PF29073`	RxLR_C	177	209	0.24	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48850`	Arabidopsis thaliana	sp\|O48850\|VA725_ARATH Vesicle-associated membrane protein 725	87.200%	Swiss-Prot	High
`P47192`	Arabidopsis thaliana	sp\|P47192\|VA722_ARATH Vesicle-associated membrane protein 722	86.400%	Swiss-Prot	High
`Q9ZTW3`	Arabidopsis thaliana	sp\|Q9ZTW3\|VA721_ARATH Vesicle-associated membrane protein 721	87.700%	Swiss-Prot	High
`Q9MAS5`	Arabidopsis thaliana	sp\|Q9MAS5\|VA726_ARATH Putative vesicle-associated membrane protein 726	84.000%	Swiss-Prot	High
`O23429`	Arabidopsis thaliana	sp\|O23429\|VA724_ARATH Vesicle-associated membrane protein 724	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card