TkA01G578270 | RubberDandelionOmics

Gene overview

TkA01G578270

Reference: TK1151 Chr: Chr01 Coordinates: 145404290-145407825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3444 bp · TkA01G578270|TK1151|cDNA

TTCTTCAAGATCTCAACACCCTGCTTTCTTTTTTAAATTTAAATTACAGAATTATTAATCTTTTCCCCATGTTATCCGCTTAACTGCTACTGCTTACTTATAATTTTATCACCACTTCACTTCCACTCATCTTTCTCCATCTAGATCCAAACACCAAAATGATCGAAATTTAACCCAATTTCAAAAAAACAGGCCCACCACCAACGCCGCCATGTCGAAACCCCATTTTCGGTTCTTCTTCTTTTTGTTGTTTTGCTTTT...

CDS

Download CDS FASTA

1413 bp · TkA01G578270|TK1151|CDS

ATGATGAGCACGCTCGCTGTTCTTGATCTGTCCAACAATTCCTTGACGGGAGGAATCCCAGAAAGCTTCGGGAATTCTCCGGCGTTAGAATCTCTGAATGTATCTTACAACAGACTTCAAGGCCCAGTGCCGGTGAACGGAATGCTAAGAACAATTAACCCCAGTGATCTCGTTGGAAACAGCGATCTATGTGGTAACATGCTCCCACCATGCACAGGGGATATGACTAACGATTCACATCACAAAGGCTTGCACACGAA...

Protein

Download Protein FASTA

470 aa · TkA01G578270|TK1151|PROTEIN

MMSTLAVLDLSNNSLTGGIPESFGNSPALESLNVSYNRLQGPVPVNGMLRTINPSDLVGNSDLCGNMLPPCTGDMTNDSHHKGLHTKHVITGWVIGMSVVLAVFLTAFAGRALYSKWYTNGSCFEERFEMGKGEWPWRLMAFQKLSFSSYDILNCVKESNVIGMGATGVVYKAEIQRTNTIVAVKKLWSSKNDIELGSSAGDFVGEVNVLGKLRHRNIVRLLGFLHNDKNAMIVYEYMSNGSLGEALHGQARLLVDWVSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578270`
TK1151 ID	TkA01G578270
OH-1004 ID	LXL04_000894
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 90.638 / OH-1004 41.888 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G578270

Location Chr01:145404290-145407825 (-)

Description Similar to MIK1: MDIS1-interacting receptor like kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At1g08590`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At5g61480`	Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G08590

ath:AT3G49670

ath:AT4G28650

ath:AT5G61480

ath:AT5G65700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.871

Rank 1 · TkA01G578270 · TK1151

Cytoplasm0.082

Rank 2 · TkA01G578270 · TK1151

Endoplasmic reticulum0.073

Rank 3 · TkA01G578270 · TK1151

Nucleus0.055

Rank 4 · TkA01G578270 · TK1151

Golgi apparatus0.021

Rank 5 · TkA01G578270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_82-39 aa

PF00560LRR_15-25 aa

PF12799LRR_45-39 aa

PF00560LRR_129-44 aa

PF00069Pkinase158-428 aa

PF07714PK_Tyr_Ser-Thr158-428 aa

PF03109ABC1162-185 aa

PF06734UL97261-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578270	`PF13855`	LRR_8	2	39	8.5e-07	29.4
TkA01G578270	`PF00560`	LRR_1	5	25	1.8e-06	27.6
TkA01G578270	`PF12799`	LRR_4	5	39	6.6e-05	23.8
TkA01G578270	`PF00560`	LRR_1	29	44	1.8e-06	27.6
TkA01G578270	`PF00069`	Pkinase	158	428	5.4e-50	170.9
TkA01G578270	`PF07714`	PK_Tyr_Ser-Thr	158	428	2.1e-44	152.5
TkA01G578270	`PF03109`	ABC1	162	185	0.049	13.5
TkA01G578270	`PF06734`	UL97	261	322	0.15	11.9
TkA01G578270	`PF03109`	ABC1	272	315	0.049	13.5
TkA01G578270	`PF01636`	APH	277	309	0.34	11.3
TkA01G578270	`PF12330`	Haspin_kinase	284	318	0.14	11.9
TkA01G578270	`PF00560`	LRR_1	441	450	1.8e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0G7`	Arabidopsis thaliana	sp\|Q9M0G7\|MIK1_ARATH MDIS1-interacting receptor like kinase 1	69.500%	Swiss-Prot	High
`Q9FRS6`	Arabidopsis thaliana	sp\|Q9FRS6\|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1	57.100%	Swiss-Prot	High
`Q9FII5`	Arabidopsis thaliana	sp\|Q9FII5\|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR	45.800%	Swiss-Prot	Medium
`Q9LHP4`	Arabidopsis thaliana	sp\|Q9LHP4\|RGI1_ARATH LRR receptor-like serine/threonine-protein kinase RGI1	39.900%	Swiss-Prot	Medium
`C0LGF5`	Arabidopsis thaliana	sp\|C0LGF5\|RGI5_ARATH LRR receptor-like serine/threonine-protein kinase RGI5	41.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card