TkA01G557490 | RubberDandelionOmics

Gene overview

TkA01G557490

Reference: TK1151 Chr: Chr01 Coordinates: 140193176-140194467 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · TkA01G557490|TK1151|cDNA

ATGGTTTCTCTGCATAATAATGATACAACATATAGCCACATTCTTGCCGACAAGGCATGCCAAATCTATTTTGTTTTCCCCGGCGAAACATCCATGGGATATGGGTTTCGTGCATTTTTCTATTTCTTAGCACTTGCTTATTGTTTCATTGGACTATCGGCCATAACTGAAAGCTTCCCACAGATCTCTTTGGCTACTATCGATGCAATACGAAACATCGGCAAACTCTATGCTGGAGGTTTAGGGCCTGGAACACTTGT...

CDS

Download CDS FASTA

900 bp · TkA01G557490|TK1151|CDS

ATGGTTTCTCTGCATAATAATGATACAACATATAGCCACATTCTTGCCGACAAGGCATGCCAAATCTATTTTGTTTTCCCCGGCGAAACATCCATGGGATATGGGTTTCGTGCATTTTTCTATTTCTTAGCACTTGCTTATTGTTTCATTGGACTATCGGCCATAACTGAAAGCTTCCCACAGATCTCTTTGGCTACTATCGATGCAATACGAAACATCGGCAAACTCTATGCTGGAGGTTTAGGGCCTGGAACACTTGT...

Protein

Download Protein FASTA

299 aa · TkA01G557490|TK1151|PROTEIN

MVSLHNNDTTYSHILADKACQIYFVFPGETSMGYGFRAFFYFLALAYCFIGLSAITESFPQISLATIDAIRNIGKLYAGGLGPGTLVGSAAFDLFPIHAVCVVVPKAGEVKKISDLGVWIVELFWSFWAYIWLYIILEVWSPNVIAVWEALFTVMQFGLLLVHAYAQDKRRELKDQRNGYHQKRGLLIYFSIHQENELDSNYQHLPQNDPSDEHFMSPESDVVSVWKQQFVDALTRYQTTTSCAFCYKVLKNYIYILFQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G557490`
TK1151 ID	TkA01G557490
OH-1004 ID	LXL04_001156
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.200
Protein coverage (%)	TK1151 93.311 / OH-1004 68.668 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G557490

Location Chr01:140193176-140194467 (-)

Description Similar to MHX: Magnesium/proton exchanger

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47600`	Vacuolar transporter that exchanges protons with Mg(2+), Zn(2+) and Fe(2+) ions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0660000`	Vacuolar transporter that exchanges protons with Mg(2+), Zn(2+) and Fe(2+) ions.	No verified direct reference in this release
`Os02g0644900`	Vacuolar transporter that exchanges protons with Mg(2+), Zn(2+) and Fe(2+) ions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002931 response to ischemia Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0007154 cell communication Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0015693 magnesium ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:0050808 synapse organization Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0070050 neuron cellular homeostasis Biological Process

KEGG gene cross-reference

ath:AT2G47600

dosa:Os02g0644900

dosa:Os11g0660000

hsa:6543

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.350

Rank 1 · TkA01G557490 · TK1151

Lysosome / Vacuole0.204

Rank 2 · TkA01G557490 · TK1151

Cell membrane0.203

Rank 3 · TkA01G557490 · TK1151

Golgi apparatus0.191

Rank 4 · TkA01G557490 · TK1151

Cytoplasm0.172

Rank 5 · TkA01G557490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex52-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G557490	`PF01699`	Na_Ca_ex	52	165	2.7e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22252`	Arabidopsis thaliana	sp\|O22252\|MHX_ARATH Magnesium/proton exchanger	47.600%	Swiss-Prot	Medium
`Q2R041`	Oryza sativa subsp. japonica	sp\|Q2R041\|MHX1_ORYSJ Magnesium/proton exchanger 1	60.000%	Swiss-Prot	Medium
`Q6H641`	Oryza sativa subsp. japonica	sp\|Q6H641\|MHX2_ORYSJ Magnesium/proton exchanger 2	59.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card