TkA01G557420 | RubberDandelionOmics

Gene overview

TkA01G557420

Reference: TK1151 Chr: Chr01 Coordinates: 140163359-140167252 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2026 bp · TkA01G557420|TK1151|cDNA

GTGAATAAACTCCCCAAAATCCAAAAGTCAGAGCCGAAGAGCGTACCATGCTTTTGTCTCTGCTTGCTCCGTGCCTGAGTCCAAGATTCTTAATCTTTACCGTCCAGATGCGAAAACGAGCCACACGAACAAGTCCATAGCAGAAACCAAGAAAAAACTGATCAAGCTGATGGCGATGAAAGCCAAAACTCAGCTGGTGGTTGGAGACGACGCGGTGTAGCCATCATCACCATCAACAATCCTCCTCTCAACTTACTCTC...

CDS

Download CDS FASTA

831 bp · TkA01G557420|TK1151|CDS

ATGCTTAGCCTAAAAAGCAGCATTGAAGAAGCACTGATATGCCCTGAAGTTAAAGCGATTGTGGTAAATGGTTCAAGGGGCAAGTTTTCTGGGGGAGCCGACGTGACAGTTTTTGGGAAATCTGACACGGTGAAGAAACAAAACAAGATTGGTTTCTTATCAATAGAATTGATCACAAACTGTTTGGAAGCTGCAAGAAAGCCTGTAGTAGCAGCCATAGATGGGCCTGCATTTGGTGGTGGACTAGAAATAGCACTGGC...

Protein

Download Protein FASTA

276 aa · TkA01G557420|TK1151|PROTEIN

MLSLKSSIEEALICPEVKAIVVNGSRGKFSGGADVTVFGKSDTVKKQNKIGFLSIELITNCLEAARKPVVAAIDGPAFGGGLEIALACHARISTPTSQLGLTELQYGIIPGFGGTQRLPRLVGLPKALEMILMSKRVNGKEAFGMSLVDDVAPADELMTTACKWALDISQATKPWVATLHRTDRLQPLKEAKIILNAARAHSRKHNPNLVHPLICIDVIEEGILSGPLKGLWKEAVALNELRQSETCKCLVHIFFAQNNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G557420`
TK1151 ID	TkA01G557420
OH-1004 ID	LXL04_029884
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.200
Protein coverage (%)	TK1151 90.942 / OH-1004 34.501 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G557420

Location Chr01:140163359-140167252 (+)

Description Similar to Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06860`	Involved in peroxisomal fatty acid beta-oxidation during seed germination.	The Arabidopsis thaliana multifunctional protein gene (MFP2) of peroxisomal beta-oxidation is essential for seedling establishment.2006 · DOI: 10.1111/j.1365-313x.2005.02650.x The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005 Peroxisomal β-oxidation regulates histone acetylation and DNA methylation in Arabidopsis .2019 · DOI: 10.1073/pnas.1904143116
`At4g29010`	Involved in peroxisomal fatty acid beta-oxidation.	A defect in beta-oxidation causes abnormal inflorescence development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.10.1911 Jasmonate biosynthesis in Arabidopsis thaliana requires peroxisomal beta-oxidation enzymes--additional proof by properties of pex6 and aim1.2007 · DOI: 10.1016/j.phytochem.2007.04.024 The multifunctional protein in peroxisomal beta-oxidation: structure and substrate specificity of the Arabidopsis thaliana protein MFP2.2010 · DOI: 10.1074/jbc.m110.106005

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0274100`	Multifunctional enzyme involved in fatty acid beta-oxidation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029884 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06860

ath:AT4G29010

bna:106389027

csv:101210295

dosa:Os02g0274100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.405

Rank 1 · TkA01G557420 · TK1151

Mitochondrion0.209

Rank 2 · TkA01G557420 · TK1151

Peroxisome0.176

Rank 3 · TkA01G557420 · TK1151

Nucleus0.143

Rank 4 · TkA01G557420 · TK1151

Plastid0.132

Rank 5 · TkA01G557420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16113ECH_26-159 aa

PF00378ECH_115-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G557420	`PF16113`	ECH_2	6	159	9.2e-18	65.5
TkA01G557420	`PF00378`	ECH_1	15	180	7.8e-34	117.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPI5`	Arabidopsis thaliana	sp\|Q9ZPI5\|MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2	57.400%	Swiss-Prot	High
`Q9ZPI6`	Arabidopsis thaliana	sp\|Q9ZPI6\|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1	48.800%	Swiss-Prot	Medium
`Q8W1L6`	Oryza sativa subsp. japonica	sp\|Q8W1L6\|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card