TkA01G552670 | RubberDandelionOmics

Gene overview

TkA01G552670

Reference: TK1151 Chr: Chr01 Coordinates: 138899341-138899832 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · TkA01G552670|TK1151|cDNA

CACTGTCATTACAGGAGCCGTGAACGTCGACTCCACCATCGTATCAATCTACTCAGTCGACAAACTCGGCCGCCGGTTTCTTCTTCTGGAAGCCGGAGTCCAAATGTTCTTCGCACAAGTCATAATCGCAATCATCCTCGCAATCAAAGTCACCGACACCTCATACAACCTCAGCACGGGTTTCGCCGTTCTAGTTGTGAATTTGTGATCATGGTGTGCACCTTCATTTCAGCCTTCGCATGGTCGTGGGGCCCATTAGG...

CDS

Download CDS FASTA

492 bp · TkA01G552670|TK1151|CDS

CACTGTCATTACAGGAGCCGTGAACGTCGACTCCACCATCGTATCAATCTACTCAGTCGACAAACTCGGCCGCCGGTTTCTTCTTCTGGAAGCCGGAGTCCAAATGTTCTTCGCACAAGTCATAATCGCAATCATCCTCGCAATCAAAGTCACCGACACCTCATACAACCTCAGCACGGGTTTCGCCGTTCTAGTTGTGAATTTGTGATCATGGTGTGCACCTTCATTTCAGCCTTCGCATGGTCGTGGGGCCCATTAGG...

Protein

Download Protein FASTA

163 aa · TkA01G552670|TK1151|PROTEIN

HCHYRSRERRLHHRINLLSRQTRPPVSSSGSRSPNVLRTSHNRNHPRNQSHRHLIQPQHGFRRSSCEFVIMVCTFISAFAWSWGPLGWLIPSETFPLETRSAGQSVNVCVNLLFTFVIAQAFLSMLCHFLSLGSSCSFRGGCLLCRYLFGFWCRKRRIFRSKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G552670`
TK1151 ID	TkA01G552670
OH-1004 ID	LXL04_001233
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.700
Protein coverage (%)	TK1151 37.423 / OH-1004 11.731 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G552670

Location Chr01:138899341-138899832 (-)

Description Similar to STP13: Sugar transport protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26340`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release
`At4g02050`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0218400`	Mediates active uptake of hexoses by sugar:proton symport (Probable).	Molecular cloning and expression analysis of a monosaccharide transporter gene OsMST4 from rice (Oryza sativa L.).2007 · DOI: 10.1007/s11103-007-9228-x
`Os07g0106200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016
`Os07g0559700`	Mediates active uptake of hexoses by sugar:proton symport (Probable).	Molecular cloning, functional characterization and expression analysis of a novel monosaccharide transporter gene OsMST6 from rice (Oryza sativa L.).2008 · DOI: 10.1007/s00425-008-0755-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001233 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:0042882 L-arabinose transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT4G02050

ath:AT5G26340

dosa:Os03g0218400

dosa:Os07g0106200

osa:4332079

rcu:8275367

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.369

Rank 1 · TkA01G552670 · TK1151

Nucleus0.194

Rank 2 · TkA01G552670 · TK1151

Cytoplasm0.171

Rank 3 · TkA01G552670 · TK1151

Cell membrane0.159

Rank 4 · TkA01G552670 · TK1151

Lysosome / Vacuole0.101

Rank 5 · TkA01G552670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr68-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G552670	`PF00083`	Sugar_tr	68	153	2.7e-15	56.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AZ2`	Arabidopsis thaliana	sp\|Q94AZ2\|STP13_ARATH Sugar transport protein 13	88.500%	Swiss-Prot	Low
`O04249`	Arabidopsis thaliana	sp\|O04249\|STP7_ARATH Sugar transport protein 7	75.400%	Swiss-Prot	Low
`Q10PW9`	Oryza sativa subsp. japonica	sp\|Q10PW9\|MST4_ORYSJ Sugar transport protein MST4	93.300%	Swiss-Prot	Low
`Q7EZD7`	Oryza sativa subsp. japonica	sp\|Q7EZD7\|MST3_ORYSJ Sugar transport protein MST3	73.300%	Swiss-Prot	Low
`Q6Z401`	Oryza sativa subsp. japonica	sp\|Q6Z401\|MST6_ORYSJ Sugar transport protein MST6	72.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card