LXL04_001233 | RubberDandelionOmics

Gene overview

LXL04_001233

Reference: OH-1004 Chr: Chr01 Coordinates: 22514776-22518743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · LXL04_001233|LXL04_001233|OH1004|cDNA

ATGGCAGGCGGAGGATTATCGGTGGCCGCTGCCGGAGGATTAGAGTTTGAGGCCAAAATCACGCCTATTGTTATCATCTCATGCATTATGGCAGCCACCGGCGGCCTTATGTTTGGTTATGACGTCGGCGTTTCAGGTGGAGTGACAGCGATGCCGGCTTTTTTGAAGAAGTTCTTTCCGGTGGTTTACAGGAAGACGGAGTCAGGCGAACTTGATAGTAATTACTGCAAATATGACAATCAAGGCTTACAATTATTCAC...

CDS

Download CDS FASTA

1563 bp · LXL04_001233|LXL04_001233|OH1004|CDS

ATGGCAGGCGGAGGATTATCGGTGGCCGCTGCCGGAGGATTAGAGTTTGAGGCCAAAATCACGCCTATTGTTATCATCTCATGCATTATGGCAGCCACCGGCGGCCTTATGTTTGGTTATGACGTCGGCGTTTCAGGTGGAGTGACAGCGATGCCGGCTTTTTTGAAGAAGTTCTTTCCGGTGGTTTACAGGAAGACGGAGTCAGGCGAACTTGATAGTAATTACTGCAAATATGACAATCAAGGCTTACAATTATTCAC...

Protein

Download Protein FASTA

520 aa · LXL04_001233|LXL04_001233|OH1004|PROTEIN

MAGGGLSVAAAGGLEFEAKITPIVIISCIMAATGGLMFGYDVGVSGGVTAMPAFLKKFFPVVYRKTESGELDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYTTRKLGRRLTMLIAGVFFIIGVIFNAGAQNLAMLIVGRILLGCGVGFANQAVPVFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTAKIEGGWGWRLSLGLAGIPAILLTVGALLVVDTPNSLIERGKLDEGKAVLKKIRGTDNVEPEYLELV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001233`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001233

Location Chr01:22514776-22518743 (+)

Description Similar to STP13: Sugar transport protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26340`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release
`At4g02050`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0218400`	Mediates active uptake of hexoses by sugar:proton symport (Probable).	Molecular cloning and expression analysis of a monosaccharide transporter gene OsMST4 from rice (Oryza sativa L.).2007 · DOI: 10.1007/s11103-007-9228-x
`Os07g0106200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001233 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:0042882 L-arabinose transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT4G02050

ath:AT5G26340

dosa:Os03g0218400

dosa:Os07g0106200

osa:4332079

rcu:8275367

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.845

Rank 1 · LXL04_001233 · OH-1004

Cytoplasm0.116

Rank 2 · LXL04_001233 · OH-1004

Endoplasmic reticulum0.040

Rank 3 · LXL04_001233 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_001233 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_001233 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr28-486 aa

PF07690.22MFS_181-431 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001233	`PF00083.31`	Sugar_tr	28	486	1.4e-123	413.9
LXL04_001233	`PF07690.22`	MFS_1	81	431	4e-26	92.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AZ2`	Arabidopsis thaliana	Sugar transport protein 13	83.721%	Swiss-Prot	strong database homology
`O04249`	Arabidopsis thaliana	Sugar transport protein 7	58.594%	Swiss-Prot	strong database homology
`Q10PW9`	Oryza sativa subsp. japonica	Sugar transport protein MST4	80.620%	Swiss-Prot	strong database homology
`Q7EZD7`	Oryza sativa subsp. japonica	Sugar transport protein MST3	59.010%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card