TkA01G547290 | RubberDandelionOmics

Gene overview

TkA01G547290

Reference: TK1151 Chr: Chr01 Coordinates: 137468560-137469087 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · TkA01G547290|TK1151|cDNA

ATGGAACGAACAGATTTGCAGAGCAATAATAAACAAAGCACCACTGCTCCCACCTCCAACACTAGTTCTTCTCACCACCACCACCACCATCACCTCTCCCACCACCTCCACCACCAACCCATGGTGGTCCCATTTGATGCTCGATCTGGAACCCCATTCATGGGCTCCATATCCATCCAACCCGGTCCATCTACCACTCCTACTACTACTAGTGGAGCTTCTTCTTCTCTTTCTTCTCCTTCTAACCAACACCCAACAAC...

CDS

Download CDS FASTA

528 bp · TkA01G547290|TK1151|CDS

ATGGAACGAACAGATTTGCAGAGCAATAATAAACAAAGCACCACTGCTCCCACCTCCAACACTAGTTCTTCTCACCACCACCACCACCATCACCTCTCCCACCACCTCCACCACCAACCCATGGTGGTCCCATTTGATGCTCGATCTGGAACCCCATTCATGGGCTCCATATCCATCCAACCCGGTCCATCTACCACTCCTACTACTACTAGTGGAGCTTCTTCTTCTCTTTCTTCTCCTTCTAACCAACACCCAACAAC...

Protein

Download Protein FASTA

175 aa · TkA01G547290|TK1151|PROTEIN

MERTDLQSNNKQSTTAPTSNTSSSHHHHHHHLSHHLHHQPMVVPFDARSGTPFMGSISIQPGPSTTPTTTSGASSSLSSPSNQHPTTSSATQLSPPHPHLVDASLAIATRSEALADLPKENPQPVAAVPPKRSTKDRHTKVDGRGRRIRMPATCAARVFQLTRELGHKSDGGRNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G547290`
TK1151 ID	TkA01G547290
OH-1004 ID	LXL04_026783
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 37.143 / OH-1004 24.265 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G547290

Location Chr01:137468560-137469087 (-)

Description Similar to TCP9: Transcription factor TCP9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58100`	Can specifically bind site II elements in the promoter region of PP438/PNM1.	An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation.2011 · DOI: 10.1105/tpc.110.081638
`At3g47620`	Transcription factor involved the regulation of plant development.	Transcription factor AtTCP14 regulates embryonic growth potential during seed germination in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2007.03308.x TCP14 and TCP15 affect internode length and leaf shape in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04674.x Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.2012 · DOI: 10.1093/jxb/err388 The Arabidopsis O-linked N-acetylglucosamine transferase SPINDLY interacts with class I TCPs to facilitate cytokinin responses in leaves and flowers.2012 · DOI: 10.1105/tpc.111.093518 The Arabidopsis immune adaptor SRFR1 interacts with TCP transcription factors that redundantly contribute to effector-triggered immunity.2014 · DOI: 10.1111/tpj.12527 The ubiquitin receptors DA1, DAR1, and DAR2 redundantly regulate endoreduplication by modulating the stability of TCP14/15 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.132274 Pseudomonas syringae Type III Effector HopBB1 Promotes Host Transcriptional Repressor Degradation to Regulate Phytohormone Responses and Virulence.2017 · DOI: 10.1016/j.chom.2017.01.003 ORANGE Represses Chloroplast Biogenesis in Etiolated Arabidopsis Cotyledons via Interaction with TCP14.2019 · DOI: 10.1105/tpc.18.00290
`At2g45680`	Transcription factor TCP9.	No verified direct reference in this release
`At1g72010`	Transcription factor TCP22.	No verified direct reference in this release
`At5g51910`	Transcription factor TCP19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026783 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009624 response to nematode Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010229 inflorescence development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G69690

ath:AT2G45680

ath:AT5G51910

dosa:Os08g0544800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.921

Rank 1 · TkA01G547290 · TK1151

Cytoplasm0.195

Rank 2 · TkA01G547290 · TK1151

Cell membrane0.022

Rank 3 · TkA01G547290 · TK1151

Mitochondrion0.020

Rank 4 · TkA01G547290 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G547290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634TCP8-38 aa

PF03634TCP133-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G547290	`PF03634`	TCP	8	38	1.5e-15	58.8
TkA01G547290	`PF03634`	TCP	133	171	1.5e-15	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C518`	Arabidopsis thaliana	sp\|Q9C518\|TCP8_ARATH Transcription factor TCP8	68.500%	Swiss-Prot	Low
`Q93Z00`	Arabidopsis thaliana	sp\|Q93Z00\|TCP14_ARATH Transcription factor TCP14	67.700%	Swiss-Prot	Low
`O64647`	Arabidopsis thaliana	sp\|O64647\|TCP9_ARATH Transcription factor TCP9	80.000%	Swiss-Prot	Low
`Q9C7G4`	Arabidopsis thaliana	sp\|Q9C7G4\|TCP22_ARATH Transcription factor TCP22	92.700%	Swiss-Prot	Low
`Q9LT89`	Arabidopsis thaliana	sp\|Q9LT89\|TCP19_ARATH Transcription factor TCP19	84.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card