TkA01G542860 | RubberDandelionOmics

Gene overview

TkA01G542860

Reference: TK1151 Chr: Chr01 Coordinates: 136219452-136220322 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA01G542860|TK1151|cDNA

GTATATGCCAAGATCGATACTCCGGCAGCTGATGTTGTGGTGGAAGGTGGTGGAATCATAAACTATTTGACGGAAAAGGATTTCCCGGTGCTTGTTGAGATGGGTTTGAGTGCAAGATTTGTGAGGTTAGAAGGTAAGGCTATATTGACACCAAGCTATGTGGTGGACGGGTCGGTTCAGATGATTTATGTTGCTAAGGGAAGTGGCGGGATGCGGGTTGTGGGTAAAGAAGGGAAGCTTATTTTTGATGGCCAAGTGAC...

CDS

Download CDS FASTA

510 bp · TkA01G542860|TK1151|CDS

GTATATGCCAAGATCGATACTCCGGCAGCTGATGTTGTGGTGGAAGGTGGTGGAATCATAAACTATTTGACGGAAAAGGATTTCCCGGTGCTTGTTGAGATGGGTTTGAGTGCAAGATTTGTGAGGTTAGAAGGTAAGGCTATATTGACACCAAGCTATGTGGTGGACGGGTCGGTTCAGATGATTTATGTTGCTAAGGGAAGTGGCGGGATGCGGGTTGTGGGTAAAGAAGGGAAGCTTATTTTTGATGGCCAAGTGAC...

Protein

Download Protein FASTA

169 aa · TkA01G542860|TK1151|PROTEIN

VYAKIDTPAADVVVEGGGIINYLTEKDFPVLVEMGLSARFVRLEGKAILTPSYVVDGSVQMIYVAKGSGGMRVVGKEGKLIFDGQVTEGDLIIIPPFYVVAVIADQSGMELFSLITSSKPVLEQLAGNMSVWKAMSPVVVQTVLNISPRLEERFRLKNSVNLMITPPRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G542860`
TK1151 ID	TkA01G542860
OH-1004 ID	LXL04_001359
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.491 / OH-1004 31.102 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G542860`
Location	Chr01:136219452-136220322 (+)
Description	Similar to At1g71180: Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001359` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006574 L-valine catabolic process Biological Process GO:0016054 organic acid catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0045121 membrane raft Cellular Component GO:0008442 3-hydroxyisobutyrate dehydrogenase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0050661 NADP binding Molecular Function GO:0051287 NAD binding Molecular Function
KEGG gene cross-reference	ath:AT1G71170 ath:AT1G71180 ath:AT4G29120 bsu:BSU13960 pcl:Pcal_0699 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.401

Rank 1 · TkA01G542860 · TK1151

Cytoplasm0.245

Rank 2 · TkA01G542860 · TK1151

Lysosome / Vacuole0.178

Rank 3 · TkA01G542860 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA01G542860 · TK1151

Nucleus0.077

Rank 5 · TkA01G542860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_16-148 aa

PF07883Cupin_252-96 aa

PF18897Gp3-like102-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G542860	`PF00190`	Cupin_1	6	148	1e-18	68.0
TkA01G542860	`PF07883`	Cupin_2	52	96	0.19	12.2
TkA01G542860	`PF18897`	Gp3-like	102	157	0.3	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card