TkA01G540060 | RubberDandelionOmics

Gene overview

TkA01G540060

Reference: TK1151 Chr: Chr01 Coordinates: 135441909-135449643 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3351 bp · TkA01G540060|TK1151|cDNA

CTTGTGTCAGTTCTTAAACAAATGCCCTCCAACTTGATTCTCTCCATCTCTCACACACCAAGTCACACACACATACACACACTATTGTCTTTATAATCAAACAACCCATTCACGGGCTACTACAAAACAACATGTGTTTCAAACCTCAATCCCTATAAAAACCACCCCACGATCCCTCCATTCTAACTTAGAGAAAAATGGCGTTAAAAAACAGAGCACTCTCTGTTTTCGCCATTCTCGCCACCTTCATGCTATGGCAA...

CDS

Download CDS FASTA

909 bp · TkA01G540060|TK1151|CDS

ATGGCGTTAAAAAACAGAGCACTCTCTGTTTTCGCCATTCTCGCCACCTTCATGCTATGGCAAACCACCATTGTTTCAGCCCAAAATACACCCGTTTTCGCTTGCGATATCGACAAGAACCCGGGTTTAAAAAACTTCTCGTTTTGTGATCCATCATTGGACGTGAAAATCCGGGTCGATGATTTGGTTAAGAGGCTCACATTACAGGAAAAGATTGTGAATTTGGTGGATAACGCCGGCAGCATCGATCGGCTCGGAAT...

Protein

Download Protein FASTA

302 aa · TkA01G540060|TK1151|PROTEIN

MALKNRALSVFAILATFMLWQTTIVSAQNTPVFACDIDKNPGLKNFSFCDPSLDVKIRVDDLVKRLTLQEKIVNLVDNAGSIDRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNETLFKTIGKVVSTEARAMYNVGLAGLTFWSPNINILRDPRWGRAQETPGEDPTLTSKYGAAYVQGLQETDDGDKDRLKVGACCKHYTAYDVDNWKGIDRYHFNAVVTKQDMDDTYQPPFKSCVVDGNVAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G540060`
TK1151 ID	TkA01G540060
OH-1004 ID	LXL04_029340
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.800
Protein coverage (%)	TK1151 96.689 / OH-1004 37.549 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G540060

Location Chr01:135441909-135449643 (+)

Description Similar to Xyl2: Beta-xylosidase/alpha-L-arabinofuranosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64570`	Beta-D-xylosidase showing an optimal efficiency with the natural substrate xylobiose.	No verified direct reference in this release
`At5g09730`	Involved in the hydrolysis of arabinan.	Purification, functional characterization, cloning, and identification of mutants of a seed-specific arabinan hydrolase in Arabidopsis.2006 · DOI: 10.1093/jxb/erj205
`At3g19620`	Probable beta-D-xylosidase 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029340 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0031222 arabinan catabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT5G09730

ath:AT5G49360

ath:AT5G64570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.975

Rank 1 · TkA01G540060 · TK1151

Cell membrane0.014

Rank 2 · TkA01G540060 · TK1151

Cytoplasm0.013

Rank 3 · TkA01G540060 · TK1151

Endoplasmic reticulum0.006

Rank 4 · TkA01G540060 · TK1151

Golgi apparatus0.005

Rank 5 · TkA01G540060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00933Glyco_hydro_3113-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G540060	`PF00933`	Glyco_hydro_3	113	298	2.7e-29	103.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLG1`	Arabidopsis thaliana	sp\|Q9FLG1\|BXL4_ARATH Beta-D-xylosidase 4	78.600%	Swiss-Prot	High
`Q9LXD6`	Arabidopsis thaliana	sp\|Q9LXD6\|BXL3_ARATH Beta-D-xylosidase 3	69.900%	Swiss-Prot	High
`Q9LJN4`	Arabidopsis thaliana	sp\|Q9LJN4\|BXL5_ARATH Probable beta-D-xylosidase 5	67.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card