LXL04_029340 | RubberDandelionOmics

Gene overview

LXL04_029340

Reference: OH-1004 Chr: Chr06 Coordinates: 87905691-87912983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2304 bp · LXL04_029340|LXL04_029340|OH1004|cDNA

ATGGCCGCAAATCCTCATGTTCTCGCCATTGCCTTTATTCTTTCGGTTTTATCAACACAGTGGATGTATGCTACGGCCCAGAATTTGCCACTTTTTGCGTGCGACATTGATAAAAATCCAACCTTGAAGAGCTTTTCGTTCTGCGATGCTTCATTGGATATAAAACTGAGGGTGAAGGATCTTGTAAAGCGGTTGACAATGGAAGAAAAAATAGGAAACTTGGTTAACAAAGCTAGCAGTGTTGATCGTCTTGGCATACC...

CDS

Download CDS FASTA

2304 bp · LXL04_029340|LXL04_029340|OH1004|CDS

ATGGCCGCAAATCCTCATGTTCTCGCCATTGCCTTTATTCTTTCGGTTTTATCAACACAGTGGATGTATGCTACGGCCCAGAATTTGCCACTTTTTGCGTGCGACATTGATAAAAATCCAACCTTGAAGAGCTTTTCGTTCTGCGATGCTTCATTGGATATAAAACTGAGGGTGAAGGATCTTGTAAAGCGGTTGACAATGGAAGAAAAAATAGGAAACTTGGTTAACAAAGCTAGCAGTGTTGATCGTCTTGGCATACC...

Protein

Download Protein FASTA

767 aa · LXL04_029340|LXL04_029340|OH1004|PROTEIN

MAANPHVLAIAFILSVLSTQWMYATAQNLPLFACDIDKNPTLKSFSFCDASLDIKLRVKDLVKRLTMEEKIGNLVNKASSVDRLGIPGYGWWSEALHGVSKTGPATFFSRVVAGATSFPQVILTAASFNETLFKTIGQVVSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAFVRGLQERDDGDKNRLKVGACCKHYTAYDVDNWKGVDRYHFNAVVTKQDMEDTFQPPFKSCVMDGNVVSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029340`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029340

Location Chr06:87905691-87912983 (+)

Description Similar to Xyl2: Beta-xylosidase/alpha-L-arabinofuranosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64570`	Beta-D-xylosidase showing an optimal efficiency with the natural substrate xylobiose.	No verified direct reference in this release
`At5g09730`	Involved in the hydrolysis of arabinan.	Purification, functional characterization, cloning, and identification of mutants of a seed-specific arabinan hydrolase in Arabidopsis.2006 · DOI: 10.1093/jxb/erj205
`At5g49360`	Involved in pectic arabinan modification in mucilage secretory cells.	AtBXL1, a novel higher plant (Arabidopsis thaliana) putative beta-xylosidase gene, is involved in secondary cell wall metabolism and plant development.2003 · DOI: 10.1046/j.1365-313x.2003.01654.x AtBXL1 encodes a bifunctional beta-D-xylosidase/alpha-L-arabinofuranosidase required for pectic arabinan modification in Arabidopsis mucilage secretory cells.2009 · DOI: 10.1104/pp.109.138388

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029340 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0031222 arabinan catabolic process Biological Process

GO:0045493 xylan catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT5G09730

ath:AT5G49360

ath:AT5G64570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.648

Rank 1 · LXL04_029340 · OH-1004

Lysosome / Vacuole0.128

Rank 2 · LXL04_029340 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_029340 · OH-1004

Cytoplasm0.064

Rank 4 · LXL04_029340 · OH-1004

Endoplasmic reticulum0.049

Rank 5 · LXL04_029340 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00933.28Glyco_hydro_3110-355 aa

PF01915.28Glyco_hydro_3_C402-631 aa

PF14310.13Fn3-like692-758 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029340	`PF00933.28`	Glyco_hydro_3	110	355	2.2e-35	123.3
LXL04_029340	`PF01915.28`	Glyco_hydro_3_C	402	631	1.3e-49	169.6
LXL04_029340	`PF14310.13`	Fn3-like	692	758	1.4e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLG1`	Arabidopsis thaliana	Beta-D-xylosidase 4	66.016%	Swiss-Prot	strong database homology
`Q9LXD6`	Arabidopsis thaliana	Beta-D-xylosidase 3	65.147%	Swiss-Prot	strong database homology
`Q9FGY1`	Arabidopsis thaliana	Beta-D-xylosidase 1	54.075%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card