TkA01G535520 | RubberDandelionOmics

Gene overview

TkA01G535520

Reference: TK1151 Chr: Chr01 Coordinates: 134392147-134394482 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1522 bp · TkA01G535520|TK1151|cDNA

GTACAGGGAGTCGAACTGTTTAATTGTAAAACATCCTTATCCTCTTCCTCACTACCAGAGAAAATGTATGTGGTGGGAGTACCAGCCTGCTAACGATGATGCCAATTTTGTGCAGCCAAAGGCTATGGGGTCTGGCCTTCATCTCCAAAACACCCACAATTTCACCAGGTTTTCCCCAATCGTTTCGTTGTCCGGTAACTTAAAAACTTCACCATGGTGTTGCTTTACCACTCGATTATACTTCAACGGGACTCATACAC...

CDS

Download CDS FASTA

714 bp · TkA01G535520|TK1151|CDS

ATGATCGGCAGCCGATCCCTCACCCTGACTACTGCTTTAGCATTCCTTGGTTTGGGATGCATAGGACTTGTTTGGGCATCCATGGAAGCTGGAAATATTAGGTCAATCTTGCTACTAGCTTCTGCCATTACTTGTGGTTACATATATCAGTGTCCGCCATTCCGGTTGAGTTACCGTGGTCTAGGAGAACCGTTATGCTTTGCAGCATTCGGTCCTTTTGCCACCACAGCTTTTTACTTATTACAAAGTAGTAGAAGTAC...

Protein

Download Protein FASTA

237 aa · TkA01G535520|TK1151|PROTEIN

MIGSRSLTLTTALAFLGLGCIGLVWASMEAGNIRSILLLASAITCGYIYQCPPFRLSYRGLGEPLCFAAFGPFATTAFYLLQSSRSTTKLKMLPITNTILSASVLVGITTSLILFCSHFHQIDDDKAVGKLSPLVRIGTETGSNVVKVAVISLYSLLVLSGICRSLPFTSIFLCAVTVPMGKVVVSFIEDNHRDKTKIFMGKYFCVRLHALFGVALSVGMVAARILTRNNVPQPVFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G535520`
TK1151 ID	TkA01G535520
OH-1004 ID	LXL04_001436
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 57.524 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G535520

Location Chr01:134392147-134394482 (-)

Description Similar to ABC4: 2-carboxy-1,4-naphthoquinone phytyltransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60600`	Involved in the synthesis of phylloquinone (vitamin K1).	Inactivation and deficiency of core proteins of photosystems I and II caused by genetical phylloquinone and plastoquinone deficiency but retained lamellar structure in a T-DNA mutant of Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2004.02326.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001436 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0009234 menaquinone biosynthetic process Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0042371 vitamin K biosynthetic process Biological Process

GO:0042372 phylloquinone biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004659 prenyltransferase activity Molecular Function

GO:0046428 1,4-dihydroxy-2-naphthoate polyprenyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60600

syn:slr1518

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.668

Rank 1 · TkA01G535520 · TK1151

Cytoplasm0.111

Rank 2 · TkA01G535520 · TK1151

Nucleus0.106

Rank 3 · TkA01G535520 · TK1151

Mitochondrion0.104

Rank 4 · TkA01G535520 · TK1151

Cell membrane0.075

Rank 5 · TkA01G535520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01040UbiA5-199 aa

PF20394DUF66889-48 aa

PF12046CCB110-49 aa

PF12046CCB165-93 aa

PF20394DUF668869-222 aa

PF12046CCB1157-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G535520	`PF01040`	UbiA	5	199	8.8e-15	55.4
TkA01G535520	`PF20394`	DUF6688	9	48	0.63	10.3
TkA01G535520	`PF12046`	CCB1	10	49	0.79	9.8
TkA01G535520	`PF12046`	CCB1	65	93	0.79	9.8
TkA01G535520	`PF20394`	DUF6688	69	222	0.63	10.3
TkA01G535520	`PF12046`	CCB1	157	177	0.79	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUA3`	Arabidopsis thaliana	sp\|Q0WUA3\|MENA_ARATH 2-carboxy-1,4-naphthoquinone phytyltransferase, chloroplastic	62.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card