TkA01G520240 | RubberDandelionOmics

Gene overview

TkA01G520240

Reference: TK1151 Chr: Chr01 Coordinates: 130425676-130426837 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

941 bp · TkA01G520240|TK1151|cDNA

ACCTCCATGATTTATATTCATCGCTTTCGGCTCTCAATTCACCAATCGACGCGACAGCCATGGGAGAAGTTGATCCAACTTTCATTCAGCAACTAGAACACAGACCTAAACTTGAAGTAACCGAAGCTCAAGGGATTCCGCAAATCGAGCTCTCGCCATTGCTAAATTCGTCTGATCCGGCGGAGGTTCATGCGGATCTGGTGGCTCAGGTCCGTGAGGCGTGCGAGAATTGGGGATTTTTCCAGGTGTTCAACCATGGC...

CDS

Download CDS FASTA

882 bp · TkA01G520240|TK1151|CDS

ATGGGAGAAGTTGATCCAACTTTCATTCAGCAACTAGAACACAGACCTAAACTTGAAGTAACCGAAGCTCAAGGGATTCCGCAAATCGAGCTCTCGCCATTGCTAAATTCGTCTGATCCGGCGGAGGTTCATGCGGATCTGGTGGCTCAGGTCCGTGAGGCGTGCGAGAATTGGGGATTTTTCCAGGTGTTCAACCATGGCATTCCCGTAGAGAGCCGTGAAAAGCTGATGGCGGCGGCGAAGAGGTTCTTCAATCAGCC...

Protein

Download Protein FASTA

294 aa · TkA01G520240|TK1151|PROTEIN

MGEVDPTFIQQLEHRPKLEVTEAQGIPQIELSPLLNSSDPAEVHADLVAQVREACENWGFFQVFNHGIPVESREKLMAAAKRFFNQPVEEKRKVRRDEAHPLGYYDTEHTKNVRDWKEVFDVTVDVPTMMWASHEPDDHQLTEYLNQWPHHLPELRAACEEYVKDVQKLSYKLLELIAFSLNIPANRFESFFSKGQTSFIRLNHYPPCPAPDLALGVGQHKDAIALTILTQDDVGGLEVKRKTDGEWIFVKPTPNTFIIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G520240`
TK1151 ID	TkA01G520240
OH-1004 ID	LXL04_001658
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 90.816 / OH-1004 37.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G520240

Location Chr01:130425676-130426837 (+)

Description Similar to DLO2: Protein DMR6-LIKE OXYGENASE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10500`	Converts salicylic acid (SA) to both 2,3-dihydroxybenzoic acid (2,3-DHBA) and 2,5-DHBA in vitro but only 2,3-DHBA in vivo.	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At1g55290`	2-oxoglutarate (OG)- and Fe(II)-dependent dioxygenase (2OGD)involved in scopoletin biosynthesis.	No verified direct reference in this release
`At3g21420`	Oxoglutarate-dependent dioxygenase involved in the biosynthesis of strigolactone natural products, bioactive compounds promoting plant fitness and soil microbe interactions, but preventing shoot branching.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001658 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10490

ath:AT4G10500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.766

Rank 1 · TkA01G520240 · TK1151

Nucleus0.346

Rank 2 · TkA01G520240 · TK1151

Peroxisome0.064

Rank 3 · TkA01G520240 · TK1151

Mitochondrion0.059

Rank 4 · TkA01G520240 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA01G520240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N26-150 aa

PF17243POTRA_TamA_139-63 aa

PF17243POTRA_TamA_196-124 aa

PF031712OG-FeII_Oxy198-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G520240	`PF14226`	DIOX_N	26	150	2.7e-31	109.4
TkA01G520240	`PF17243`	POTRA_TamA_1	39	63	0.12	13.2
TkA01G520240	`PF17243`	POTRA_TamA_1	96	124	0.12	13.2
TkA01G520240	`PF03171`	2OG-FeII_Oxy	198	267	3e-20	73.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSA7`	Arabidopsis thaliana	sp\|Q9ZSA7\|DLO2_ARATH Protein DMR6-LIKE OXYGENASE 2	34.100%	Swiss-Prot	Medium
`Q9ZSA8`	Arabidopsis thaliana	sp\|Q9ZSA8\|DLO1_ARATH Protein DMR6-LIKE OXYGENASE 1	32.200%	Swiss-Prot	Medium
`Q9C899`	Arabidopsis thaliana	sp\|Q9C899\|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2	36.800%	Swiss-Prot	Medium
`Q9LIF4`	Arabidopsis thaliana	sp\|Q9LIF4\|LBO1_ARATH Protein LATERAL BRANCHING OXIDOREDUCTASE 1	35.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card