TkA01G516000 | RubberDandelionOmics

Gene overview

TkA01G516000

Reference: TK1151 Chr: Chr01 Coordinates: 129341451-129342563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

637 bp · TkA01G516000|TK1151|cDNA

CAAATTGGTCCCTACTTTCTTCCATTGATGTCTTCCAGGTACTGCTGGTACAACAGATGTCTACTACAAGCAAATCATGTCACTTTCCATGAAGGGTTATCGGGTGAATTCTGTTGGTATTCCCCGTGTATGGAACAATCAAGAATGGGTTCAAGCATTTGAGAAGTTTTTGGATGTTATTGATGTTCATCCTATACATCTTTATGGCACATCTCTTGGAGGATTTTTAGCACCACTTTTTGCTCAACATAGACCACAAA...

CDS

Download CDS FASTA

561 bp · TkA01G516000|TK1151|CDS

ATGTCACTTTCCATGAAGGGTTATCGGGTGAATTCTGTTGGTATTCCCCGTGTATGGAACAATCAAGAATGGGTTCAAGCATTTGAGAAGTTTTTGGATGTTATTGATGTTCATCCTATACATCTTTATGGCACATCTCTTGGAGGATTTTTAGCACCACTTTTTGCTCAACATAGACCACAAAGAGTGAAGTCATTAGTCCTCTCAAATGCATTTTTGGATACAAAATATTTCTCAGCTGCCATGCATTGGGCTCCTGT...

Protein

Download Protein FASTA

186 aa · TkA01G516000|TK1151|PROTEIN

MSLSMKGYRVNSVGIPRVWNNQEWVQAFEKFLDVIDVHPIHLYGTSLGGFLAPLFAQHRPQRVKSLVLSNAFLDTKYFSAAMHWAPVVRWTPSFLLKRYVLTGIPNGPHELFIADSVDFVAAQVETLSRGDLASRLTLTSDAAFVGHLLISNTLITIMDVCFDNSYTFFNILIARNNNLLIFICFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G516000`
TK1151 ID	TkA01G516000
OH-1004 ID	LXL04_005808
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.500
Protein coverage (%)	TK1151 85.484 / OH-1004 40.152 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G516000`
Location	Chr01:129341451-129342563 (-)
Description	Similar to SPG21: Maspardin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005808` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007166 cell surface receptor signaling pathway Biological Process GO:0007173 epidermal growth factor receptor signaling pathway Biological Process GO:0010467 gene expression Biological Process GO:0050851 antigen receptor-mediated signaling pathway Biological Process GO:0070849 response to epidermal growth factor Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0010008 endosome membrane Cellular Component GO:0030140 trans-Golgi network transport vesicle Cellular Component GO:0042609 CD4 receptor binding Molecular Function
KEGG gene cross-reference	bta:404069 hsa:51324 mmu:27965 xla:734314 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.329

Rank 1 · TkA01G516000 · TK1151

Cytoplasm0.244

Rank 2 · TkA01G516000 · TK1151

Mitochondrion0.172

Rank 3 · TkA01G516000 · TK1151

Nucleus0.158

Rank 4 · TkA01G516000 · TK1151

Golgi apparatus0.114

Rank 5 · TkA01G516000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12697Abhydrolase_624-123 aa

PF00326Peptidase_S925-81 aa

PF00561Abhydrolase_126-105 aa

PF12146Hydrolase_428-100 aa

PF00909Ammonium_transp29-97 aa

PF00326Peptidase_S9160-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G516000	`PF12697`	Abhydrolase_6	24	123	0.00044	21.6
TkA01G516000	`PF00326`	Peptidase_S9	25	81	0.02	15.1
TkA01G516000	`PF00561`	Abhydrolase_1	26	105	2e-09	38.2
TkA01G516000	`PF12146`	Hydrolase_4	28	100	1.4e-06	28.6
TkA01G516000	`PF00909`	Ammonium_transp	29	97	0.023	14.2
TkA01G516000	`PF00326`	Peptidase_S9	160	181	0.02	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card