TkA01G507300 | RubberDandelionOmics

Gene overview

TkA01G507300

Reference: TK1151 Chr: Chr01 Coordinates: 127063295-127066622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1079 bp · TkA01G507300|TK1151|cDNA

CATGCCTCGTCATCTAGCCGTCTAAATATTTTCCACCCCACATCTACATCCGTCGTCTATCACTGTGCCACGTAAACCCTCTTCTTATCAATAAACAAACGGCTATTATTCATCCACGCGTCGTTGTTGATGCGTTATTACTTATTACACCCTCGATCCAACGGACCGCGGCACTCGTTTCCACAGCTTTCATAGTATCGAACACTTTTGCCTGCACCCCCAACATCCCCGGAGCTCCGGCTGACTCTTCTAGAGCCGGA...

CDS

Download CDS FASTA

651 bp · TkA01G507300|TK1151|CDS

ATGGCGGATTCCGATAACGAATCGGGAGGACACAACGCGGGCGGTGATTTGTCGGCGAGAGAGCAAGACAGGTTTCTTCCGATTGCTAACGTGAGTCGGATCATGAAGAAGGCGTTACCGGCGAACGCAAAGATCTCCAAGGATGCGAAGGAAACAGTACAGGAGTGCGTGTCGGAGTTCATCAGCTTCATAACCGGCGAGGCGTCGGATAAGTGCCAGAGGGAGAAGAGGAAGACGATTAACGGCGACGATTTGCTATG...

Protein

Download Protein FASTA

216 aa · TkA01G507300|TK1151|PROTEIN

MADSDNESGGHNAGGDLSAREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLAKYRELEGEKTTMGRPGEKDGSSGGGVDSAAGGGATGGGVTSGGYNGMYGGYHQMYNSGQYQQTGMGMGMGVGVGSPTGSLGRSGSIGRGGGASSLKPGTIFCGLWFYITD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G507300`
TK1151 ID	TkA01G507300
OH-1004 ID	LXL04_012655
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	74.800
Protein coverage (%)	TK1151 52.778 / OH-1004 48.178 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G507300

Location Chr01:127063295-127066622 (+)

Description Similar to NFYB8: Nuclear transcription factor Y subunit B-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14540`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release
`At5g47640`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release
`At2g38880`	Component of the NF-Y/HAP transcription factor complex (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0606600`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`Os03g0413000`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012655 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G37060

ath:AT3G53340

dosa:Os01g0834400

osa:9268669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA01G507300 · TK1151

Cytoplasm0.166

Rank 2 · TkA01G507300 · TK1151

Cell membrane0.015

Rank 3 · TkA01G507300 · TK1151

Mitochondrion0.015

Rank 4 · TkA01G507300 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA01G507300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15511CENP-T_C22-89 aa

PF00808CBFD_NFYB_HMF25-89 aa

PF00125Histone26-89 aa

PF07524Bromo_TP48-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G507300	`PF15511`	CENP-T_C	22	89	0.0056	17.5
TkA01G507300	`PF00808`	CBFD_NFYB_HMF	25	89	1.4e-27	96.4
TkA01G507300	`PF00125`	Histone	26	89	3e-05	25.0
TkA01G507300	`PF07524`	Bromo_TP	48	94	0.27	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23310`	Arabidopsis thaliana	sp\|O23310\|NFYB3_ARATH Nuclear transcription factor Y subunit B-3	89.000%	Swiss-Prot	Medium
`Q9FGJ3`	Arabidopsis thaliana	sp\|Q9FGJ3\|NFYB2_ARATH Nuclear transcription factor Y subunit B-2	79.500%	Swiss-Prot	Medium
`Q9SLG0`	Arabidopsis thaliana	sp\|Q9SLG0\|NFYB1_ARATH Nuclear transcription factor Y subunit B-1	69.600%	Swiss-Prot	Medium
`Q69J40`	Oryza sativa subsp. japonica	sp\|Q69J40\|NFYBA_ORYSJ Nuclear transcription factor Y subunit B-10	88.800%	Swiss-Prot	Medium
`Q75IZ7`	Oryza sativa subsp. japonica	sp\|Q75IZ7\|NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8	86.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card