LXL04_012655 | RubberDandelionOmics

Gene overview

LXL04_012655

Reference: OH-1004 Chr: Chr03 Coordinates: 16350786-16352343 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_012655|LXL04_012655|OH1004|cDNA

ATGAGGAGTGTAACTGTAACTAAATCAGTAGGCATCGTACAACTGTTGGCATCTAAAAGAGGCAGAGTGTACCAAACCAACGGTGTTGATAAAACAGACCTTCGCATATCCATCGTCACCTCTCTCCCTTCTTCTCCAGCGTCCGATCTTCTTCATCAACGCTTCTCGCGCCCAAAATTTCTCCAGAATTTTACGAATTTCTCTCACTCCAACGGTCCAGGCGGTGGAAGCCATGAGAGCGGTGGGGATCTGAGTCCAAG...

CDS

Download CDS FASTA

744 bp · LXL04_012655|LXL04_012655|OH1004|CDS

ATGAGGAGTGTAACTGTAACTAAATCAGTAGGCATCGTACAACTGTTGGCATCTAAAAGAGGCAGAGTGTACCAAACCAACGGTGTTGATAAAACAGACCTTCGCATATCCATCGTCACCTCTCTCCCTTCTTCTCCAGCGTCCGATCTTCTTCATCAACGCTTCTCGCGCCCAAAATTTCTCCAGAATTTTACGAATTTCTCTCACTCCAACGGTCCAGGCGGTGGAAGCCATGAGAGCGGTGGGGATCTGAGTCCAAG...

Protein

Download Protein FASTA

247 aa · LXL04_012655|LXL04_012655|OH1004|PROTEIN

MRSVTVTKSVGIVQLLASKRGRVYQTNGVDKTDLRISIVTSLPSSPASDLLHQRFSRPKFLQNFTNFSHSNGPGGGSHESGGDLSPRSSNVREQDRFLPIANISRIMKKGLPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKSYLNRYREGDTKGSAKGHDGSSRKDAHNDAKFGIQNPYTQGLNYVNSQVDTVVFLIGLLAQGQHMMMPMQRTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012655`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012655

Location Chr03:16350786-16352343 (+)

Description Similar to NFYB8: Nuclear transcription factor Y subunit B-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37060`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release
`At3g53340`	Component of the NF-Y/HAP transcription factor complex.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0573500`	Component of the NF-Y/HAP transcription factor complex.	OsHAP3 genes regulate chloroplast biogenesis in rice.2003 · DOI: 10.1046/j.1365-313x.2003.01897.x
`Os01g0834400`	Component of the NF-Y/HAP transcription factor complex.	OsHAP3 genes regulate chloroplast biogenesis in rice.2003 · DOI: 10.1046/j.1365-313x.2003.01897.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012655 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G37060

ath:AT3G53340

dosa:Os01g0834400

osa:9268669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.897

Rank 1 · LXL04_012655 · OH-1004

Cytoplasm0.190

Rank 2 · LXL04_012655 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_012655 · OH-1004

Mitochondrion0.020

Rank 4 · LXL04_012655 · OH-1004

Endoplasmic reticulum0.018

Rank 5 · LXL04_012655 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00808.30CBFD_NFYB_HMF97-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012655	`PF00808.30`	CBFD_NFYB_HMF	97	161	2.3e-27	95.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYK4`	Arabidopsis thaliana	Nuclear transcription factor Y subunit B-8	69.399%	Swiss-Prot	strong database homology
`Q67XJ2`	Arabidopsis thaliana	Nuclear transcription factor Y subunit B-10	66.279%	Swiss-Prot	moderate database homology
`Q60EQ4`	Oryza sativa subsp. japonica	Nuclear transcription factor Y subunit B-3	72.535%	Swiss-Prot	moderate database homology
`Q5QMG3`	Oryza sativa subsp. japonica	Nuclear transcription factor Y subunit B-2	63.975%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card