TkA01G507250 | RubberDandelionOmics

Gene overview

TkA01G507250

Reference: TK1151 Chr: Chr01 Coordinates: 127037791-127041917 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2163 bp · TkA01G507250|TK1151|cDNA

TAAAAATAACGGAAACATAACGGGTGAGATGTAATAAACTAATTGAATCGTTCCCGTATAAATCAAAATCGGCTTCTGCGGTGTTGTATTTCCCGGTGATCGCTCGCGTAGGGTTTTGCTTAAAATTTTCCGACAACTCGCTCGTATATACACACACAAACAAATTCTGGTGTTCTCCCTTCGAAATTGAACTAAAATCTTCTCGATTGTGTACAGAAAATCAGTGTTAGTTATTTGGAAATTCTAGGGTTTCGTCACCG...

CDS

Download CDS FASTA

1659 bp · TkA01G507250|TK1151|CDS

ATGGGTCGTTCACGCGCAGTCAATCACTCTGCAGAGGAGGATTCCAGCCAGAGTCGATCAAAGAGAAAGAGACCCACATCAAATCTGGAGAATCTAGAGGCTGCAACTTCAGGGCAAGGGATGAGTGAAGGAAAAAAGGCTTTGTACCATTGTAACTACTGCAACAAGGACATTTCAGGAAAGATTCGCATAAAATGTGCTTGTTGTTCTGACTTTGATCTTTGTGTTGAGTGTTTTTCTGTTGGTGCTGAGGTGTATCC...

Protein

Download Protein FASTA

552 aa · TkA01G507250|TK1151|PROTEIN

MGRSRAVNHSAEEDSSQSRSKRKRPTSNLENLEAATSGQGMSEGKKALYHCNYCNKDISGKIRIKCACCSDFDLCVECFSVGAEVYPHKSNHPYRVMDNLSFPLFCSDWNADEEILLLEGIEMYGLANWNEVAEHVGTKSKSHCIEHYNTIYMNSPCFPLPDMSHVMGKNREELLAMARGHGEATKGLPTGGELLVKEESPFSARIKVEASTTVNPSTGAGKRTSTISQTDKGGDGIKIEDSHADRSFGEKKLRTSVEEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G507250`
TK1151 ID	TkA01G507250
OH-1004 ID	LXL04_001820
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G507250

Location Chr01:127037791-127041917 (+)

Description Similar to ADA2: Transcriptional adapter ADA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07740`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	No verified direct reference in this release
`At4g16420`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression.2003 · DOI: 10.1105/tpc.007922 PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation.2003 · DOI: 10.1016/s0960-9822(03)00327-0 Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses.2011 · DOI: 10.1007/s00425-010-1337-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0750800`	Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity).	Rice Homeodomain Protein WOX11 Recruits a Histone Acetyltransferase Complex to Establish Programs of Cell Proliferation of Crown Root Meristem.2017 · DOI: 10.1105/tpc.16.00908

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000183 rDNA heterochromatin formation Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010520 regulation of reciprocal meiotic recombination Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0030447 filamentous growth Biological Process

KEGG gene cross-reference

ath:AT3G07740

ath:AT4G16420

cal:CAALFM_C110860CA

dosa:Os03g0750800

sce:YDR448W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA01G507250 · TK1151

Cytoplasm0.104

Rank 2 · TkA01G507250 · TK1151

Cell membrane0.021

Rank 3 · TkA01G507250 · TK1151

Mitochondrion0.011

Rank 4 · TkA01G507250 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G507250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00569ZZ47-83 aa

PF25299ZZ_ADA251-97 aa

PF23588HTH_CHD1_Hrp3104-133 aa

PF00249Myb_DNA-binding108-150 aa

PF13921Myb_DNA-bind_6109-150 aa

PF22941TADA2A-like_3rd266-335 aa

PF24533Tri-helical_Ada2b_C341-352 aa

PF00249Myb_DNA-binding360-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G507250	`PF00569`	ZZ	47	83	8.9e-08	32.6
TkA01G507250	`PF25299`	ZZ_ADA2	51	97	2.1e-14	54.1
TkA01G507250	`PF23588`	HTH_CHD1_Hrp3	104	133	0.0051	17.5
TkA01G507250	`PF00249`	Myb_DNA-binding	108	150	4e-12	46.8
TkA01G507250	`PF13921`	Myb_DNA-bind_6	109	150	4.7e-07	30.6
TkA01G507250	`PF22941`	TADA2A-like_3rd	266	335	1.6e-28	99.4
TkA01G507250	`PF24533`	Tri-helical_Ada2b_C	341	352	0.16	12.5
TkA01G507250	`PF00249`	Myb_DNA-binding	360	371	4e-12	46.8
TkA01G507250	`PF13921`	Myb_DNA-bind_6	360	371	4.7e-07	30.6
TkA01G507250	`PF24533`	Tri-helical_Ada2b_C	485	507	0.16	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFD5`	Arabidopsis thaliana	sp\|Q9SFD5\|TAD2A_ARATH Transcriptional adapter ADA2a	55.200%	Swiss-Prot	High
`Q9ATB4`	Arabidopsis thaliana	sp\|Q9ATB4\|TAD2B_ARATH Transcriptional adapter ADA2b	54.100%	Swiss-Prot	High
`Q75LL6`	Oryza sativa subsp. japonica	sp\|Q75LL6\|TADA2_ORYSJ Transcriptional adapter ADA2	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card