LXL04_001820 | RubberDandelionOmics

Gene overview

LXL04_001820

Reference: OH-1004 Chr: Chr01 Coordinates: 34244773-34248324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_001820|LXL04_001820|OH1004|cDNA

ATGGGTCGTTCACGCGCAGTCAATCACTCTGCAGAGGAGGATTCCAGCCAGAGTCGATCAAAGAGAAAGAGACCCACATCAAATCTGGAGAATCTAGAGGCTGCAACTTCAGGGCAAGGGATGAGTGAAGGAAAAAAGGCTTTGTACCATTGTAACTACTGCAACAAGGACATTTCAGGAAAGATTCGCATAAAATGTGCTTGTTGTTCTGACTTTGATCTTTGTGTTGAGTGTTTTTCTGTTGGTGCTGAGGTGTATCC...

CDS

Download CDS FASTA

1659 bp · LXL04_001820|LXL04_001820|OH1004|CDS

ATGGGTCGTTCACGCGCAGTCAATCACTCTGCAGAGGAGGATTCCAGCCAGAGTCGATCAAAGAGAAAGAGACCCACATCAAATCTGGAGAATCTAGAGGCTGCAACTTCAGGGCAAGGGATGAGTGAAGGAAAAAAGGCTTTGTACCATTGTAACTACTGCAACAAGGACATTTCAGGAAAGATTCGCATAAAATGTGCTTGTTGTTCTGACTTTGATCTTTGTGTTGAGTGTTTTTCTGTTGGTGCTGAGGTGTATCC...

Protein

Download Protein FASTA

552 aa · LXL04_001820|LXL04_001820|OH1004|PROTEIN

MGRSRAVNHSAEEDSSQSRSKRKRPTSNLENLEAATSGQGMSEGKKALYHCNYCNKDISGKIRIKCACCSDFDLCVECFSVGAEVYPHKSNHPYRVMDNLSFPLFCSDWNADEEILLLEGIEMYGLANWNEVAEHVGTKSKSHCIEHYNTIYMNSPCFPLPDMSHVMGKNREELLAMARGHGEATKGLPTGGELLVKEESPFSARIKVEASTTVNPSTGAGKRTSTISQTDKGGDGIKIEDSHADRSFGEKKLRTSVEEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001820`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001820

Location Chr01:34244773-34248324 (-)

Description Similar to ADA2: Transcriptional adapter ADA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07740`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	No verified direct reference in this release
`At4g16420`	Required for the function of some acidic activation domains, which activate transcription from a distant site.	Disruption mutations of ADA2b and GCN5 transcriptional adaptor genes dramatically affect Arabidopsis growth, development, and gene expression.2003 · DOI: 10.1105/tpc.007922 PROPORZ1, a putative Arabidopsis transcriptional adaptor protein, mediates auxin and cytokinin signals in the control of cell proliferation.2003 · DOI: 10.1016/s0960-9822(03)00327-0 Arabidopsis thaliana transcriptional co-activators ADA2b and SGF29a are implicated in salt stress responses.2011 · DOI: 10.1007/s00425-010-1337-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0750800`	Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity).	Rice Homeodomain Protein WOX11 Recruits a Histone Acetyltransferase Complex to Establish Programs of Cell Proliferation of Crown Root Meristem.2017 · DOI: 10.1105/tpc.16.00908

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001820 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000183 rDNA heterochromatin formation Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010520 regulation of reciprocal meiotic recombination Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0030447 filamentous growth Biological Process

KEGG gene cross-reference

ath:AT3G07740

ath:AT4G16420

cal:CAALFM_C110860CA

dosa:Os03g0750800

sce:YDR448W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_001820 · OH-1004

Cytoplasm0.104

Rank 2 · LXL04_001820 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_001820 · OH-1004

Mitochondrion0.011

Rank 4 · LXL04_001820 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_001820 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00569.24ZZ47-83 aa

PF25299.2ZZ_ADA251-97 aa

PF00249.38Myb_DNA-binding108-150 aa

PF13921.13Myb_DNA-bind_6109-150 aa

PF22941.2TADA2A-like_3rd266-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001820	`PF00569.24`	ZZ	47	83	8.9e-08	32.6
LXL04_001820	`PF25299.2`	ZZ_ADA2	51	97	2.1e-14	54.1
LXL04_001820	`PF00249.38`	Myb_DNA-binding	108	150	4e-12	46.8
LXL04_001820	`PF13921.13`	Myb_DNA-bind_6	109	150	4.6e-07	30.6
LXL04_001820	`PF22941.2`	TADA2A-like_3rd	266	335	1.6e-28	99.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFD5`	Arabidopsis thaliana	Transcriptional adapter ADA2a	53.996%	Swiss-Prot	strong database homology
`Q9ATB4`	Arabidopsis thaliana	Transcriptional adapter ADA2b	53.707%	Swiss-Prot	strong database homology
`Q75LL6`	Oryza sativa subsp. japonica	Transcriptional adapter ADA2	58.541%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card