TkA01G504490 | RubberDandelionOmics

Gene overview

TkA01G504490

Reference: TK1151 Chr: Chr01 Coordinates: 126313111-126315895 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1547 bp · TkA01G504490|TK1151|cDNA

GAAGACTTGAGCTCCACCCCTACCCTACCAACCACCAATCTCTTATCATTACCGGCCCCCATGATAAAAATCAATCAAACTTAAAAGCATAAACCTACCTTCTTTAAAAATCTCTTCTTCTGCTACTCGGTTAGTTCTTCCCTAATTTTTAAATAACTATACCCATCTACCATATCAGATTTCGGGAAATCATTTTCCCTCAGATTTCCGACACCCTGTTACGCATCAAGTTCAAACGCCTTACCCAAAATAGATTGCCA...

CDS

Download CDS FASTA

966 bp · TkA01G504490|TK1151|CDS

ATGTATGGAACACAAAGCAAGAAGGATTTATCGCTCGAAATTCAATCACAAATACCCATCTTGAGACCAAGCATCCATTCTAGAAGGGCGAATATCACTGTAAAATTCCAAGATCTTTATGGGTTTACTGTTGAAGGCAATGTCGATGACGCAAACACAATAAATGACGTGAGAGAGAAAGTGAGGGAACAAGGTAAGGTTTGGTGGTCATTAGAAGCTAGCAAAGGGGCAAATTGGTATTTGCAAACCGACGTATCGTC...

Protein

Download Protein FASTA

321 aa · TkA01G504490|TK1151|PROTEIN

MYGTQSKKDLSLEIQSQIPILRPSIHSRRANITVKFQDLYGFTVEGNVDDANTINDVREKVREQGKVWWSLEASKGANWYLQTDVSSALKASLKFSVLVNAITLKKLIRKGIPPVLRPKVWFSLSGAAKKKSTVPDSYYNDLIIAVEGKVTPATKQIDHDLPRTFPGHPWLDTPEGHASLRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAFWMLAVLLENVLVNDCYSSNLSGCHVEQRVFKDLLKKKCPSIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G504490`
TK1151 ID	TkA01G504490
OH-1004 ID	LXL04_001842
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.131 / OH-1004 79.949 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G504490`
Location	Chr01:126313111-126315895 (+)
Description	Similar to TBC1D2: TBC1 domain family member 2A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001842` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043547 positive regulation of GTPase activity Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030054 cell junction Cellular Component GO:0031410 cytoplasmic vesicle Cellular Component GO:0070161 anchoring junction Cellular Component GO:0005096 GTPase activator activity Molecular Function GO:0045296 cadherin binding Molecular Function
KEGG gene cross-reference	bta:513828 dre:406635 hsa:55357 mmu:381605 rno:313234 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · TkA01G504490 · TK1151

Nucleus0.238

Rank 2 · TkA01G504490 · TK1151

Golgi apparatus0.122

Rank 3 · TkA01G504490 · TK1151

Cell membrane0.118

Rank 4 · TkA01G504490 · TK1151

Endoplasmic reticulum0.089

Rank 5 · TkA01G504490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01357Expansin_C47-99 aa

PF00566RabGAP-TBC116-317 aa

PF23436RabGap-TBC_2179-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G504490	`PF01357`	Expansin_C	47	99	0.029	15.2
TkA01G504490	`PF00566`	RabGAP-TBC	116	317	3.2e-57	194.4
TkA01G504490	`PF23436`	RabGap-TBC_2	179	315	6.7e-29	101.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card