Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA01G502030|TK1151|cDNA
ATGGGTTTTGTAGATTTTCTGGATTTGGAATCGATACGTGATTACGTTCTCGGTGAAGGGGCTAACTTACTTTTGCGGATGAAATGGATGTCGAGTTTTAAAGGGGTTCCCATGTCTGATCATTGGCTTCAAAGCCGGTTCACATATGTTCAACTTAGTACCCTAAAATCCAAGGTCGGAGTTTTTGTCTGCAACTATAGCCATCCTCACGAGTTCAGGTTTGTTTCTCTTTATGTGTTTGGGATCTCCCTGCCTCATTG...
321 bp · TkA01G502030|TK1151|CDS
ATGGGTTTTGTAGATTTTCTGGATTTGGAATCGATACGTGATTACGTTCTCGGTGAAGGGGCTAACTTACTTTTGCGGATGAAATGGATGTCGAGTTTTAAAGGGGTTCCCATGTCTGATCATTGGCTTCAAAGCCGGTTCACATATGTTCAACTTAGTACCCTAAAATCCAAGGTCGGAGTTTTTGTCTGCAACTATAGCCATCCTCACGAGTTCAGGTTTGTTTCTCTTTATGTGTTTGGGATCTCCCTGCCTCATTG...
Protein
Download Protein FASTA106 aa · TkA01G502030|TK1151|PROTEIN
MGFVDFLDLESIRDYVLGEGANLLLRMKWMSSFKGVPMSDHWLQSRFTYVQLSTLKSKVGVFVCNYSHPHEFRFVSLYVFGISLPHCFSCCFAITSENCCCSLVGF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G502030 |
|---|---|
| TK1151 ID | TkA01G502030 |
| OH-1004 ID | LXL04_016205 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 72.400 |
| Protein coverage (%) | TK1151 27.358 / OH-1004 3.558Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G502030 |
|---|---|
| Location | Chr01:125742239-125742683 (-) |
| Description | Similar to FIM5: Fimbrin-5 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007623 circadian rhythm Biological Process GO:0009846 pollen germination Biological Process GO:0009860 pollen tube growth Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0051017 actin filament bundle assembly Biological Process GO:0051639 actin filament network formation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005884 actin filament Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0032432 actin filament bundle Cellular Component |
| KEGG gene cross-reference | ath:AT2G04750 ath:AT4G26700 ath:AT5G35700 ath:AT5G48460 ath:AT5G55400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.