TkA01G498690 | RubberDandelionOmics

Gene overview

TkA01G498690

Reference: TK1151 Chr: Chr01 Coordinates: 124973171-124973571 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA01G498690|TK1151|cDNA

ATGATGGGATGGGCCGGCGTCATCTGGATTTACAGCATCGTCTTCTACTTCCCTCTCGACATCATGAAATTCGCCATCAGATATATCCTCAGCGGCAAAGCATGGCACGATCTCCTAGACAACAAGACTGCTTTTACATCGAAGAAGGATTACGGAAGAGAAGAGAGAGAAGCTCAATTGGCACTTGGTCAGAGGACATTACACGGTCTTCAAGCACCGGAAGCTTCCAACATCTTCAACGAAAAAAGCAGTTACAGAGA...

CDS

Download CDS FASTA

309 bp · TkA01G498690|TK1151|CDS

ATGATGGGATGGGCCGGCGTCATCTGGATTTACAGCATCGTCTTCTACTTCCCTCTCGACATCATGAAATTCGCCATCAGATATATCCTCAGCGGCAAAGCATGGCACGATCTCCTAGACAACAAGACTGCTTTTACATCGAAGAAGGATTACGGAAGAGAAGAGAGAGAAGCTCAATTGGCACTTGGTCAGAGGACATTACACGGTCTTCAAGCACCGGAAGCTTCCAACATCTTCAACGAAAAAAGCAGTTACAGAGA...

Protein

Download Protein FASTA

102 aa · TkA01G498690|TK1151|PROTEIN

MMGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWHDLLDNKTAFTSKKDYGREEREAQLALGQRTLHGLQAPEASNIFNEKSSYRELSEIAEHALMSFFDI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G498690`
TK1151 ID	TkA01G498690
OH-1004 ID	LXL04_017998
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 91.176 / OH-1004 9.748 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G498690

Location Chr01:124973171-124973571 (-)

Description Similar to PMA4: Plasma membrane ATPase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30190`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Mechanism of proton transport by plant plasma membrane proton ATPases.2003 · DOI: 10.1007/s10265-003-0111-9 The effect of a genetically reduced plasma membrane protonmotive force on vegetative growth of Arabidopsis.2012 · DOI: 10.1104/pp.111.189167 Abscisic acid suppresses hypocotyl elongation by dephosphorylating plasma membrane H(+)-ATPase in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu028 The plasma membrane H(+) -ATPase AHA2 contributes to the root architecture in response to different nitrogen supply.2015 · DOI: 10.1111/ppl.12305 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 Direct observation of proton pumping by a eukaryotic P-type ATPase.2016 · DOI: 10.1126/science.aad6429
`At2g24520`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At2g18960`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0656100`	The plasma membrane ATPase of plants and fungi is a hydrogen ion pump.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017998 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008553 P-type proton-exporting transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G24520

ath:AT4G30190

dosa:Os04g0656100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.330

Rank 1 · TkA01G498690 · TK1151

Cytoplasm0.270

Rank 2 · TkA01G498690 · TK1151

Nucleus0.203

Rank 3 · TkA01G498690 · TK1151

Cell membrane0.106

Rank 4 · TkA01G498690 · TK1151

Endoplasmic reticulum0.095

Rank 5 · TkA01G498690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P19456`	Arabidopsis thaliana	sp\|P19456\|PMA2_ARATH ATPase 2, plasma membrane-type	80.600%	Swiss-Prot	High
`Q9SJB3`	Arabidopsis thaliana	sp\|Q9SJB3\|PMA5_ARATH ATPase 5, plasma membrane-type	73.100%	Swiss-Prot	High
`P20649`	Arabidopsis thaliana	sp\|P20649\|PMA1_ARATH ATPase 1, plasma membrane-type	78.500%	Swiss-Prot	High
`Q7XPY2`	Oryza sativa subsp. japonica	sp\|Q7XPY2\|PMA1_ORYSJ Plasma membrane ATPase	78.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card