LXL04_017998 | RubberDandelionOmics

Gene overview

LXL04_017998

Reference: OH-1004 Chr: Chr04 Coordinates: 4814938-4822216 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2865 bp · LXL04_017998|LXL04_017998|OH1004|cDNA

ATGGGTGGTGATAAAGCGCTTAGTCTCGAAGAGATTAAAAACGAGACAGTTGATCTGGAAAAAGTACCAATCGAGGAAGTGTTTGAGCAACTGAAATGTAACCGCGAAGGTCTAAGCTCAGATGAAGGGGCCAGTAGGCTTGAAATTTTCGGCCCGAATAAATTGGAGGAGAAAAGGGAAAGCAAGTTGCTCAAGTTTCTTGGGTTTATGTGGAACCCACTCTCATGGGTCATGGAAGCGGCTGCCATCATGGCCATCGC...

CDS

Download CDS FASTA

2865 bp · LXL04_017998|LXL04_017998|OH1004|CDS

ATGGGTGGTGATAAAGCGCTTAGTCTCGAAGAGATTAAAAACGAGACAGTTGATCTGGAAAAAGTACCAATCGAGGAAGTGTTTGAGCAACTGAAATGTAACCGCGAAGGTCTAAGCTCAGATGAAGGGGCCAGTAGGCTTGAAATTTTCGGCCCGAATAAATTGGAGGAGAAAAGGGAAAGCAAGTTGCTCAAGTTTCTTGGGTTTATGTGGAACCCACTCTCATGGGTCATGGAAGCGGCTGCCATCATGGCCATCGC...

Protein

Download Protein FASTA

954 aa · LXL04_017998|LXL04_017998|OH1004|PROTEIN

MGGDKALSLEEIKNETVDLEKVPIEEVFEQLKCNREGLSSDEGASRLEIFGPNKLEEKRESKLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGRWSEQEASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVNKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017998`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017998

Location Chr04:4814938-4822216 (-)

Description Similar to PMA4: Plasma membrane ATPase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30190`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Mechanism of proton transport by plant plasma membrane proton ATPases.2003 · DOI: 10.1007/s10265-003-0111-9 The effect of a genetically reduced plasma membrane protonmotive force on vegetative growth of Arabidopsis.2012 · DOI: 10.1104/pp.111.189167 Abscisic acid suppresses hypocotyl elongation by dephosphorylating plasma membrane H(+)-ATPase in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu028 The plasma membrane H(+) -ATPase AHA2 contributes to the root architecture in response to different nitrogen supply.2015 · DOI: 10.1111/ppl.12305 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 Direct observation of proton pumping by a eukaryotic P-type ATPase.2016 · DOI: 10.1126/science.aad6429
`At2g24520`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0656100`	The plasma membrane ATPase of plants and fungi is a hydrogen ion pump.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017998 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008553 P-type proton-exporting transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G24520

ath:AT4G30190

dosa:Os04g0656100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.678

Rank 1 · LXL04_017998 · OH-1004

Endoplasmic reticulum0.135

Rank 2 · LXL04_017998 · OH-1004

Cytoplasm0.100

Rank 3 · LXL04_017998 · OH-1004

Lysosome / Vacuole0.075

Rank 4 · LXL04_017998 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_017998 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690.32Cation_ATPase_N21-84 aa

PF00122.26E1-E2_ATPase134-232 aa

PF00702.33Hydrolase328-605 aa

PF13246.13Cation_ATPase376-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017998	`PF00690.32`	Cation_ATPase_N	21	84	1.6e-15	57.2
LXL04_017998	`PF00122.26`	E1-E2_ATPase	134	232	7.5e-33	113.1
LXL04_017998	`PF00702.33`	Hydrolase	328	605	2.5e-15	58.1
LXL04_017998	`PF13246.13`	Cation_ATPase	376	496	1.9e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P19456`	Arabidopsis thaliana	ATPase 2, plasma membrane-type	87.012%	Swiss-Prot	strong database homology
`Q9SJB3`	Arabidopsis thaliana	ATPase 5, plasma membrane-type	84.144%	Swiss-Prot	strong database homology
`Q7XPY2`	Oryza sativa subsp. japonica	Plasma membrane ATPase	88.285%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card