TkA01G493010 | RubberDandelionOmics

Gene overview

TkA01G493010

Reference: TK1151 Chr: Chr01 Coordinates: 123381654-123382037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA01G493010|TK1151|cDNA

ATGGCTGAATATTCGGAGACAGAAATCCCATATCCCCATAGAGCCGGGGTGTTGTTCCAGGTTTACAAGGCTGTATTTTTTACCGATCAAGCTTCTGACACAACCCCTGTATCGTTGAGGAGAAGAGCTTGGCTGCAAAGCTTTGATCAGTTGTTGACGCCTTACGTGTCAAGCAACCCAAGAGAGGCGTTTATCAACTACAACGATGTGGATTTGGGTGTTGCAAATGCTAATTTTGAAGAAGCGAGTGCTTGGGGTGA...

CDS

Download CDS FASTA

384 bp · TkA01G493010|TK1151|CDS

ATGGCTGAATATTCGGAGACAGAAATCCCATATCCCCATAGAGCCGGGGTGTTGTTCCAGGTTTACAAGGCTGTATTTTTTACCGATCAAGCTTCTGACACAACCCCTGTATCGTTGAGGAGAAGAGCTTGGCTGCAAAGCTTTGATCAGTTGTTGACGCCTTACGTGTCAAGCAACCCAAGAGAGGCGTTTATCAACTACAACGATGTGGATTTGGGTGTTGCAAATGCTAATTTTGAAGAAGCGAGTGCTTGGGGTGA...

Protein

Download Protein FASTA

127 aa · TkA01G493010|TK1151|PROTEIN

MAEYSETEIPYPHRAGVLFQVYKAVFFTDQASDTTPVSLRRRAWLQSFDQLLTPYVSSNPREAFINYNDVDLGVANANFEEASAWGDRYWKRENFEKLVRIKAEVDPENFFRHPQSIPVFSTSLSDI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G493010`
TK1151 ID	TkA01G493010
OH-1004 ID	LXL04_001979
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 11.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G493010

Location Chr01:123381654-123382037 (-)

Description Similar to MEE23: Berberine bridge enzyme-like 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44400`	Berberine bridge enzyme-like 26.	No verified direct reference in this release
`At5g44390`	Berberine bridge enzyme-like 25.	No verified direct reference in this release
`At5g44380`	Berberine bridge enzyme-like 24.	No verified direct reference in this release
`At1g30760`	Mediates oxidation of p-hydroxylated derivatives of cinnamyl alcohol (i.e. the monolignols p-coumaryl-, coniferyl-, and sinapyl alcohol) to their corresponding aldehydes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

GO:0050328 tetrahydroberberine oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ag:ADY15026

ath:AT2G34790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.332

Rank 1 · TkA01G493010 · TK1151

Endoplasmic reticulum0.221

Rank 2 · TkA01G493010 · TK1151

Lysosome / Vacuole0.192

Rank 3 · TkA01G493010 · TK1151

Extracellular0.112

Rank 4 · TkA01G493010 · TK1151

Nucleus0.106

Rank 5 · TkA01G493010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08031BBE63-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G493010	`PF08031`	BBE	63	118	4.5e-20	72.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKU8`	Arabidopsis thaliana	sp\|Q9FKU8\|BBE26_ARATH Berberine bridge enzyme-like 26	49.200%	Swiss-Prot	Medium
`Q9FKU9`	Arabidopsis thaliana	sp\|Q9FKU9\|BBE25_ARATH Berberine bridge enzyme-like 25	47.500%	Swiss-Prot	Medium
`Q9FKV0`	Arabidopsis thaliana	sp\|Q9FKV0\|BBE24_ARATH Berberine bridge enzyme-like 24	46.700%	Swiss-Prot	Medium
`Q93ZA3`	Arabidopsis thaliana	sp\|Q93ZA3\|BBE13_ARATH Monolignol oxidoreductase AtBBE-like 13	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card