RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G488640
Reference: TK1151 Chr: Chr01 Coordinates: 122243447-122255038 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4818 bp · TkA01G488640|TK1151|cDNA

GAGGTCACTAAAGATTACTTGTCTGTGTGTGCCAGCGTGAGACATGTGTGTGATGATTGATTGCTACAATTAAATATCTCAACCAAAAATATTTGATTCTTTATAAAGACAACTCCTTTCCTTTCTATCCACAACAACAAAAAGTTATCCATCTGAAACAAGAAAATACACAATGCAGTTTTGAGTTTTCAACAAAACAAGCAAAACCCCAATTTAAATCGTGAAGTTTTTATCACTTAGTGAGTGAAAATGGATGGAAG...

CDS

Download CDS FASTA

4281 bp · TkA01G488640|TK1151|CDS

ATGGATGGAAGTGATATATACAAGGCTAGTAGAAGCTTCAAATCTGTAGGTAGTATGAGAGTGAAGAGTTTTAGTAGCCGTACGAGTTCATGGAGGGATGGTGGGTTGGATGTTTTCTCTCAATCAAATCGACATGATGGGGATGATGATGAAGAAGCTCTGAAATGGGCTGTTCTTGAAAAGCTGCCGACTTTTGATAGATTGAAAAAAGGCCTGTTGTATGGATCTAGTGGACCACCTGACGAGATTTTTGTAGATAA...

Protein

Download Protein FASTA

1426 aa · TkA01G488640|TK1151|PROTEIN

MDGSDIYKASRSFKSVGSMRVKSFSSRTSSWRDGGLDVFSQSNRHDGDDDEEALKWAVLEKLPTFDRLKKGLLYGSSGPPDEIFVDNLGVEDRKHLLDRLVKVAEEDNEKFLLKLRDRIDTVGLDLPTIEVRFEHLTVEADAFTGSRSLPSFLNFNIEILEAFLNMFHLLPNRKKHITILEDLSGIIKPSRMTLLLGPPSSGKTTLLLALAGKLSKELTRSGRVSYNGHELHEFVPERTSAYISQNDLHIGEMTVRETLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G488640
TK1151 IDTkA01G488640
OH-1004 IDLXL04_002036
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G488640
LocationChr01:122243447-122255038 (+)
DescriptionSimilar to PDR1: Pleiotropic drug resistance protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g15520 May participate in transmembrane ABA import and associated signaling.
PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid.2010 · DOI: 10.1073/pnas.0909222107
ABA transport factors found in Arabidopsis ABC transporters.2010 · DOI: 10.4161/psb.5.9.12566
Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.2015 · DOI: 10.1094/mpmi-02-15-0025-r
Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002036 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002229 defense response to oomycetes Biological Process
GO:0006952 defense response Biological Process
GO:0009408 response to heat Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0009914 hormone transport Biological Process
GO:0010193 response to ozone Biological Process
KEGG gene cross-reference
ath:AT1G15520
nta:107799533
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.604
Rank 1 · TkA01G488640 · TK1151
Endoplasmic reticulum0.163
Rank 2 · TkA01G488640 · TK1151
Lysosome / Vacuole0.137
Rank 3 · TkA01G488640 · TK1151
Cytoplasm0.105
Rank 4 · TkA01G488640 · TK1151
Golgi apparatus0.079
Rank 5 · TkA01G488640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20720nSTAND385-119 aa
PF13207AAA_1787-131 aa
PF14510ABC_trans_N105-155 aa
PF13191AAA_16172-230 aa
PF01637ATPase_2172-217 aa
PF02367TsaE173-215 aa
PF03193RsgA_GTPase178-217 aa
PF00005ABC_tran180-363 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G488640PF20720nSTAND3851190.001518.9
TkA01G488640PF13207AAA_17871310.3112.1
TkA01G488640PF14510ABC_trans_N1051552.8e-0628.3
TkA01G488640PF13191AAA_161722305.6e-0627.7
TkA01G488640PF01637ATPase_21722170.311.6
TkA01G488640PF02367TsaE1732150.0813.6
TkA01G488640PF03193RsgA_GTPase1782170.00318.1
TkA01G488640PF00005ABC_tran1803638.5e-40137.2
TkA01G488640PF13481AAA_251842160.0001322.3
TkA01G488640PF20720nSTAND31862170.001518.9
TkA01G488640PF13555AAA_291882101.5e-0525.3
TkA01G488640PF03215Rad171882320.01815.7
TkA01G488640PF25199nSTAND_NTPase51882150.1113.0
TkA01G488640PF13604AAA_301892160.008316.6
TkA01G488640PF13476AAA_231902350.0002122.7
TkA01G488640PF13401AAA_221912230.002918.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M9E1Arabidopsis thalianasp|Q9M9E1|AB40G_ARATH ABC transporter G family member 4070.000%Swiss-ProtHigh

JBrowse

View in Genome Browser